CoraLite® Plus 488-conjugated Apolipoprotein AI Recombinant monoclonal antibody

• 

  IF Staining of HepG2 using CL488-83504

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using CoraLite® Plus 488 Apolipoprotein AI antibody (CL488-83504, Clone: 240269F1 ) at dilution of 1:200, CL594-phalloidin (red).

Apolipoprotein AI Uni-rAb^® Recombinant Antibody for IF/ICC

Cat No. CL488-83504

Clone No.240269F1

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC

Synonyms

APOA1, apolipoprotein A I, APOA 1, ApoA I, ApoAI

---

Tested Applications

• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-83504 targets Apolipoprotein AI in IF/ICC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg0757

  Product name: Recombinant Human APOA1 protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 25-267 aa of BC005380

  Sequence: DEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ

• Full Name: apolipoprotein A-I
• Calculated Molecular Weight: 31 kDa
• Observed Molecular Weight: 26-30 kDa
• GenBank Accession Number: BC005380
• Gene Symbol: APOA1
• Gene ID (NCBI): 335
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P02647
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

ApoA1 is a major protein component of high density lipoproteins (HDL) which is associated with reversed cholesterol transport, lipid/cholesterol binding, lecithin/cholesterol acyltransferase (LCAT) activation and specific receptors binding. It is synthesized in the liver and small intestine. Defects of ApoA1 cause low HDL level and systemic non-neuropathic amyloidosis. Serum concentration of ApoA1 is inversely related to the risk of developing atherosclerosis.