CoraLite® Plus 488-conjugated Arginase-1 Recombinant monoclonal antibody

Arginase-1 Uni-rAb® Recombinant Antibody for IF/ICC
Cat No. CL488-82975
Clone No.4M7

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC

ARG1, Arginase 1, liver Arginase, 4M7, ARG 1

Formulation:  PBS and Azide
PBS and Azide
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-82975 targets Arginase-1 in IF/ICC applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag8595

Product name: Recombinant human ARG1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-236 aa of BC005321

Sequence: MSAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVTRTVNTAVAITLACFGLAREGNHKPIDYLNPPK

Predict reactive species
Full Name arginase, liver
Calculated Molecular Weight236aa,25 kDa; 322aa,35 kDa
Observed Molecular Weight 35-36 kDa
GenBank Accession NumberBC005321
Gene Symbol Arginase-1
Gene ID (NCBI) 383
RRIDAB_3673161
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP05089
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Arginase-1 (Liver arginase) belongs to the arginase family. ARG1 is a novel immunohistochemical marker of hepatocellular differentiation in fine needle aspiration cytology and a marker of hepatocytes and hepatocellular neoplasms. ARG1 is closely associated with alternative macrophage activation and ARG1 has been shown to protectmotor neurons from trophic factor deprivation and allow sensory neurons to overcome neurite outgrowth inhibition by myelin proteins (PMID: 20071539, PMID:12098359). It can exsit as a homotrimer and it has 3 isoforms produced by alternative splicing (PMID:16141327). Defects in ARG1 are the cause of argininemia (ARGIN). Deletion or TNF-mediated restriction of ARG1 unleashes the production of NO by NOS2, which is critical for pathogen control (PMID:27117406). ARG1 mainly expresses in neurons in a normal brain. The expression of ARG1 increases in microglia/macrophages and astrocytes early after CNS injuries. ARG1 has been regarded as a marker for beneficial microglia/macrophages and possesses antiinflammatory and tissue repair properties under various pathological conditions (PMID: 26538310, PMID: 31619589).

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 Arginase-1 antibody CL488-82975Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...