• Featured Product
  • KD/KO Validated

Arp5/ACTR5 Monoclonal antibody, PBS Only

Arp5/ACTR5 Monoclonal Antibody for WB, Indirect ELISA
Cat No. 67326-1-PBS
Clone No.1E11C1

Host / Isotype

Mouse / IgG1

Reactivity

Human, mouse, rat, pig

Applications

WB, Indirect ELISA

Actin related protein 5, ACTR5, Arp5, Arp5/ACTR5, FLJ12785, hARP5, INO80M, Sarcoma antigen NY SAR 16

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

67326-1-PBS targets Arp5/ACTR5 in WB, Indirect ELISA applications and shows reactivity with Human, mouse, rat, pig samples.

Tested Reactivity Human, mouse, rat, pig
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag15976

Product name: Recombinant human ACTR5 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 258-607 aa of BC038402

Sequence: EELHKWRCPDYYENNVHKMQLPFSSKLLGSTLTSEEKQERLQQQLRRLQELNARRREEKLQLDQERLDRLLYVQELLEDGQMDQFHKALIELNMDSPEELQSYIQKLSIAVEQAKQKILQAEVNLEVDVVDSKPETPDLEQLEPSLEDVESMNDFDPLFSEETPGVEKPVTTVQPVFNLAAYHQLFVGTERIRAPEIIFQPSLIGEEQAGIAETLQYILDRYPKDVQEMLVQNVFLTGGNTMYPGMKARMEKELLEMRPFRSSFQVQLASNPVLDAWYGARDWALNHLDDNEVWITRKEYEEKGGEYLKEHCASNIYVPIRLPKQASRSSDAQASSKGSAAGGGGAGEQA

Predict reactive species
Full Name ARP5 actin-related protein 5 homolog (yeast)
Calculated Molecular Weight 607 aa, 68 kDa
Observed Molecular Weight 68 kDa
GenBank Accession NumberBC038402
Gene Symbol ARP5/ACTR5
Gene ID (NCBI) 79913
RRIDAB_2882585
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ9H9F9
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Arp5 is a member of nuclear actin-related proteins (ARPs) that function as components of the chromatin- remodeling complex. Recently study reported that Arp5 regulates smooth muscle cell differentiation through interaction with myocardin (Myocd). Arp5 has been identified as negative regulator of Myocd, suppressing Myocd activity in the nucleus through tightly binding with Myocd RPEL motifs. Alternative splicing results in two variants of Arp5: a broadly expressed arp5-common, and a smooth muscle restricted arp5-sm. Expression of Arp5-sm protein is strongly suppressed in well-differentiated smooth muscle cells by partial messenger RNA decay and translational suppression. (24567363)

Loading...
||
New chat Able
正在加载,请稍候...