Ataxin 2 Monoclonal antibody

• Home
• Products
• Primary Antibodies
• Ataxin 2 Monoclonal antibody (68316-1-Ig)

• 

  WB analysis using 68316-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 68316-1-Ig (Ataxin 2 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of rat brain using 68316-1-Ig

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 68316-1-Ig (Ataxin 2 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat brain using 68316-1-Ig

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 68316-1-Ig (Ataxin 2 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of rat brain using 68316-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed rat brain tissue using Ataxin 2 antibody (68316-1-Ig, Clone: 1E8A2 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

• 

  IF Staining of rat brain using 68316-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed rat brain tissue using Ataxin 2 antibody (68316-1-Ig, Clone: 1E8A2 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

Ataxin 2 Monoclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 68316-1-Ig

Clone No.1E8A2

Publications(1)

Reviews (1)

Host / Isotype

Mouse / IgM

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, ELISA

Synonyms

ATXN2, 1E8A2, ataxin2, Ataxin-2, ATX2

---

Tested Applications

• Positive WB detected in: LNCaP cells, HeLa cells, HEK-293 cells, HepG2 cells, MCF-7 cells, Jurkat cells, HSC-T6 cells, NIH/3T3 cells, 4T1 cells
• Positive IHC detected in: rat brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: rat brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunohistochemistry (IHC): IHC : 1:250-1:1000
• Immunofluorescence (IF)-P: IF-P : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

68316-1-Ig targets Ataxin 2 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgM
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17402

  Product name: Recombinant human Ataxin 2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 251-600 aa of BC114546

  Sequence: GSDQRVVNGGVPWPSPCPSPSSRPPSRYQSGPNSLPPRAATPTRPPSRPPSRPSRPPSHPSAHGSPAPVSTMPKRMSSEGPPRMSPKAQRHPRNHRVSAGRGSISSGLEFVSHNPPSEAATPPVARTSPSGGTWSSVVSGVPRLSPKTHRPRSPRQNSIGNTPSGPVLASPQAGIIPTEAVAMPIPAASPTPASPASNRAVTPSSEAKDSRLQDQRQNSPAGNKENIKPNETSPSFSKAENKGISPVVSEHRKQIDDLKKFKNDFRLQPSSTSESMDQLLNKNREGEKSRDLIKDKIEPSAKDSFIENSSSNCTSGSSKPNSPSISPSILSNTEHKRGPEVTSQGVQTSS

• Full Name: ataxin 2
• Calculated Molecular Weight: 1313 aa, 140 kDa
• Observed Molecular Weight: 140-150 kDa
• GenBank Accession Number: BC114546
• Gene Symbol: ATXN2
• Gene ID (NCBI): 6311
• RRID: AB_3085052
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Caprylic acid/ammonium sulfate precipitation
• UNIPROT ID: Q99700
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ATXN2 contains a repeat structure with 22 or 23 triplets coding for glutamine and the (CAG)8CAA(CAG)4CAA(CAG)8 sequence; expansion of this domain to a size ≥34 triplets with a pure CAG sequence primarily causes autosomal dominant SCA2 [PMID:18418684], while ATXN2 expansions with CAA interruptions were observed as the cause of Levo-dopa responsive Parkinson's disease [PMID:10668726]. ATXN2 expansions associated with ALS were reported to be interrupted by at least one CAA triplet [PMID:21537950]

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		Nat Cell Biol; Stress granules restrain ferroptosis by sequestering ferritin; Authors - Zehe Ge

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Aditya (Verified Customer) (10-08-2024)

sensitive enough to use flourescent secondary. fantastic

• Applications: Western Blot