CoraLite® Plus 488-conjugated Ataxin 2 Monoclonal antibody

Ataxin 2 Monoclonal Antibody for IF-P
Cat No. CL488-68316
Clone No.1E8A2

Host / Isotype

Mouse / IgM

Reactivity

Human, Mouse, Rat

Applications

IF-P

ataxin 2, ATX2, ATXN2, FLJ46772, SCA2, TNRC13

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inrat brain tissue

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-68316 targets Ataxin 2 in IF-P applications and shows reactivity with Human, Mouse, Rat samples.

Tested Reactivity Human, Mouse, Rat
Host / Isotype Mouse / IgM
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag17402

Product name: Recombinant human Ataxin 2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 251-600 aa of BC114546

Sequence: GSDQRVVNGGVPWPSPCPSPSSRPPSRYQSGPNSLPPRAATPTRPPSRPPSRPSRPPSHPSAHGSPAPVSTMPKRMSSEGPPRMSPKAQRHPRNHRVSAGRGSISSGLEFVSHNPPSEAATPPVARTSPSGGTWSSVVSGVPRLSPKTHRPRSPRQNSIGNTPSGPVLASPQAGIIPTEAVAMPIPAASPTPASPASNRAVTPSSEAKDSRLQDQRQNSPAGNKENIKPNETSPSFSKAENKGISPVVSEHRKQIDDLKKFKNDFRLQPSSTSESMDQLLNKNREGEKSRDLIKDKIEPSAKDSFIENSSSNCTSGSSKPNSPSISPSILSNTEHKRGPEVTSQGVQTSS

Predict reactive species
Full Name ataxin 2
Calculated Molecular Weight 1313 aa, 140 kDa
Observed Molecular Weight140-150 kDa
GenBank Accession NumberBC114546
Gene Symbol ATXN2
Gene ID (NCBI) 6311
RRIDAB_3084472
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodCaprylic acid/ammonium sulfate precipitation
UNIPROT IDQ99700
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

ATXN2 contains a repeat structure with 22 or 23 triplets coding for glutamine and the (CAG)8CAA(CAG)4CAA(CAG)8 sequence; expansion of this domain to a size ≥34 triplets with a pure CAG sequence primarily causes autosomal dominant SCA2 [PMID:18418684], while ATXN2 expansions with CAA interruptions were observed as the cause of Levo-dopa responsive Parkinson's disease [PMID:10668726]. ATXN2 expansions associated with ALS were reported to be interrupted by at least one CAA triplet [PMID:21537950]

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 Ataxin 2 antibody CL488-68316Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...