Mouse Atox1 Recombinant monoclonal antibody, PBS Only (Detector)

• 

  Sandwich ELISA standard curve of MP01193-1

  Sandwich ELISA standard curve of MP01193-1, Mouse Atox1 Recombinant Matched Antibody Pair - PBS only. 84305-1-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Ag35290. 84305-2-PBS was HRP conjugated as the detection antibody. Range: 3.13-200 ng/mL

• 

  Sample test of MP01193-1

  The mean Atox1 concentration was determined to be 89.29 ng/mL in mouse brain tissue extract based on a 2.0 mg/mL extract load.

• 

  Cytometric bead array standard curve of MP01193-1

  Cytometric bead array standard curve of MP01193-1, MOUSE Atox1 Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 84305-1-PBS. Detection antibody: 84305-2-PBS. Standard: Ag35290. Range: 0.313-40 ng/mL.

Atox1 Uni-rAb^® Recombinant Antibody for Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

Cat No. 84305-2-PBS

Clone No.241566C2

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

Synonyms

Atx1, HAH1

---

Product Information

84305-2-PBS targets Atox1 as part of a matched antibody pair:

MP01193-1: 84305-1-PBS capture and 84305-2-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag35290

  Product name: Recombinant mouse Atox1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-68 aa of NM_009720

  Sequence: MPKHEFSVDMTCEGCAEAVSRVLNKLGGVEFNIDLPNKKVCIDSEHSSDTLLATLNKTGKAVSYLGPK

• Full Name: ATX1 (antioxidant protein 1) homolog 1 (yeast)
• Calculated Molecular Weight: 7 kDa
• GenBank Accession Number: NM_009720
• Gene Symbol: Atox1
• Gene ID (NCBI): 11927
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O08997
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.