B3GNT2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• B3GNT2 Polyclonal antibody, PBS Only (14200-1-PBS)

• 

  WB analysis using 14200-1-AP (same clone as 14200-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 14200-1-AP (B3GNT2 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14200-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 14200-1-AP (same clone as 14200-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 14200-1-AP (B3GNT2 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14200-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 14200-1-AP (same clone as 14200-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 14200-1-AP (B3GNT2 antibody) at dilution of 1:600 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 14200-1-PBS in a different storage buffer formulation.

B3GNT2 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 14200-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

B3GALT7, b3Gal-T7, B3GNT1, Beta-1,3-galactosyltransferase 7, Beta-1,3-GalTase 7

---

Product Information

14200-1-PBS targets B3GNT2 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5404

  Product name: Recombinant human B3GNT2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 47-397 aa of BC030579

  Sequence: KFWKISTPPEAYWNREQEKLNRQYNPILSMLTNQTGEAGRLSNISHLNYCEPDLRVTSVVTGFNNLPDRFKDFLLYLRCRNYSLLIDQPDKCAKKPFLLLAIKSLTPHFARRQAIRESWGQESNAGNQTVVRVFLLGQTPPEDNHPDLSDMLKFESEKHQDILMWNYRDTFFNLSLKEVLFLRWVSTSCPDTEFVFKGDDDVFVNTHHILNYLNSLSKTKAKDLFIGDVIHNAGPHRDKKLKYYIPEVVYSGLYPPYAGGGGFLYSGHLALRLYHITDQVHLYPIDDVYTGMCLQKLGLVPEKHKGFRTFDIEEKNKNNICSYVDLMLVHSRKPQEMIDIWSQLQSAHLKC

• Full Name: UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 2
• Calculated Molecular Weight: 45 kDa
• Observed Molecular Weight: 45 kDa, 69 kDa
• GenBank Accession Number: BC030579
• Gene Symbol: B3GNT2
• Gene ID (NCBI): 10678
• RRID: AB_3085431
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NY97
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

β-1,3-N-acetylglucosaminyltransferase (B3GNT2) is the most abundant and ubiquitously expressed B3GNT isoform and displays the greatest in vitro activity for N-glycan and O-glycan poly-LacNAc extensionis. B3GNT2 encodes a poly-N-acetyllactosamine synthase that targets >10 ligands and receptors to disrupt interactions between tumor and T cells and reduce T cell activation (PMID: 35338135, 32663509). B3GNT2 also has five predicted N-glycosylation sites at asparagine residues 79, 89, 127, 173, and 219 (PMID: 33229435). Western blots indicated the glycosylated form of B3GNT2 is detected at ~ 67 kDa.