B4GALT4 Polyclonal antibody

• 

  WB analysis using 15200-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15200-1-AP (B4GALT4 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse skeletal muscle using 15200-1-AP

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 15200-1-AP (B4GALT4 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human kidney using 15200-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 15200-1-AP (B4GALT4 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human kidney using 15200-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 15200-1-AP (B4GALT4 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of A549 using 15200-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed A549 cells using B4GALT4 antibody (15200-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CoraLite®594 Beta Actin antibody (CL594-66009, Clone: 2D4H5, red).

B4GALT4 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 15200-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

beta4Gal T4, Beta-1,4-GalTase 4, Beta-1,4-galactosyltransferase 4, Beta 1,4 GalTase 4, b4Gal-T4

---

Tested Applications

• Positive WB detected in: Caco-2 cells, mouse skeletal muscle tissue, PC-3 cells, HaCaT cells, HepG2 cells
• Positive IHC detected in: human kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A549 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

15200-1-AP targets B4GALT4 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7348

  Product name: Recombinant human B4GALT4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 36-344 aa of BC004523

  Sequence: GAIQEIPKAKEFMANFHKTLILGKGKTLTNEASTKKVELDNCPSVSPYLRGQSKLIFKPDLTLEEVQAENPKVSRGRYRPEECKALQRVAILVPHRNREKHLMYLLEHLHPFLQRQQLDYGIYVIHQAEGKKFNRAKLLNVGYLEALKEENWDCFIFHDVDLVPENDFNLYKCEEHPKHLVVGRNSTGYRLRYSGYFGGVTALSREQFFKVNGFSNNYWGWGGEDDDLRLRVELQRMKISRPLPEVGKYTMVFHTRDKGNEVNAERMKLLHQVSRVWRTDGLSSCSYKLVSVEHNPLYINITVDFWFGA

• Full Name: UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 4
• Calculated Molecular Weight: 40 kDa
• Observed Molecular Weight: 42 kDa
• GenBank Accession Number: BC004523
• Gene Symbol: B4GALT4
• Gene ID (NCBI): 8702
• RRID: AB_2290074
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O60513
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.