B4GALT4 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• B4GALT4 Polyclonal antibody (15200-1-AP)

• KD/KO Validated

B4GALT4 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 15200-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

B4Gal T4, b4Gal-T4, Beta 1,4 GalTase 4, Beta-1,4-galactosyltransferase 4, Beta-1,4-GalTase 4

• 

  WB analysis of HaCaT using 15200-1-AP

  WB result of B4GALT4 antibody (15200-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-B4GALT4 transfected HaCaT cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 15200-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15200-1-AP (B4GALT4 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse skeletal muscle using 15200-1-AP

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 15200-1-AP (B4GALT4 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 15200-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 15200-1-AP (B4GALT4 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 15200-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 15200-1-AP (B4GALT4 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of A549 using 15200-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed A549 cells using B4GALT4 antibody (15200-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2), CoraLite®594 Beta Actin antibody (CL594-66009, Clone: 2D4H5, red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for B4GALT4 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: Caco-2 cells, HaCaT cells, mouse skeletal muscle tissue, PC-3 cells, HepG2 cells
• Positive IHC detected in: human kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A549 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

15200-1-AP targets B4GALT4 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7348

  Product name: Recombinant human B4GALT4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 36-344 aa of BC004523

  Sequence: GAIQEIPKAKEFMANFHKTLILGKGKTLTNEASTKKVELDNCPSVSPYLRGQSKLIFKPDLTLEEVQAENPKVSRGRYRPEECKALQRVAILVPHRNREKHLMYLLEHLHPFLQRQQLDYGIYVIHQAEGKKFNRAKLLNVGYLEALKEENWDCFIFHDVDLVPENDFNLYKCEEHPKHLVVGRNSTGYRLRYSGYFGGVTALSREQFFKVNGFSNNYWGWGGEDDDLRLRVELQRMKISRPLPEVGKYTMVFHTRDKGNEVNAERMKLLHQVSRVWRTDGLSSCSYKLVSVEHNPLYINITVDFWFGA

• Full Name: UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 4
• Calculated Molecular Weight: 40 kDa
• Observed Molecular Weight: 42 kDa
• GenBank Accession Number: BC004523
• Gene Symbol: B4GALT4
• Gene ID (NCBI): 8702
• RRID: AB_2290074
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O60513
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The B4GALT4 Polyclonal antibody (Cat# 15200-1-AP) has a total of 1 citation. It appears in the Journal of Pharmaceutical and Biomedical Analysis (IF 3.4), published in 2025. The cited study investigates the mechanism of Cordyceps sinensis in treating COPD in rats by integrating proteomics, metabolomics, and network pharmacology. The associated research fields are pharmacology and respiratory disease (COPD).

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		J Pharm Biomed Anal; Integrating proteomics, metabolomics, and network pharmacology to investigate the mechanism of Cordyceps sinensis in the treatment of COPD rats; Authors - Wenbin Zhou