B4GALT6 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• B4GALT6 Polyclonal antibody, PBS Only (20148-1-PBS)

• 

  WB analysis of HEK-293 using 20148-1-AP (same clone as 20148-1-PBS)

  WB result of B4GALT6 antibody (20148-1-AP; 1:4000; incubated at room temperature for 1.5 hours) with sh-Control and sh-B4GALT6 transfected HEK-293 cells. This data was developed using the same antibody clone with 20148-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse heart using 20148-1-AP (same clone as 20148-1-PBS)

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 20148-1-AP (B4GALT6 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20148-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse kidney using 20148-1-AP (same clone as 20148-1-PBS)

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 20148-1-AP (B4GALT6 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20148-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse brain using 20148-1-AP (same clone as 20148-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 20148-1-AP (B4GALT6 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20148-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 20148-1-AP (same clone as 20148-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 20148-1-AP (B4GALT6 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20148-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon using 20148-1-AP (same clone as 20148-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon using 20148-1-AP (B4GALT6 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 20148-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon using 20148-1-AP (same clone as 20148-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon using 20148-1-AP (B4GALT6 antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 20148-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human brain using 20148-1-AP (same clone as 20148-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brain using 20148-1-AP (B4GALT6 antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 20148-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human brain using 20148-1-AP (same clone as 20148-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brain using 20148-1-AP (B4GALT6 antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 20148-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 20148-1-AP (same clone as 20148-1-PBS)

  Immunofluorescent analysis of Hela cells, using B4GALT6 antibody 20148-1-AP at 1:25 dilution and Rhodamine-labeled goat anti-rabbit IgG (red). This data was developed using the same antibody clone with 20148-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

B4GALT6 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 20148-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

20148-1-PBS targets B4GALT6 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13686

  Product name: Recombinant human B4GALT6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-382 aa of BC074884

  Sequence: MSVLRRMMRVSNRSLLAFIFFFSLSSSCLYFIYVAPGIANTYLFMVQARGIMLRENVKTIGHMIRLYTNKNSTLNGTDYPEGNNSSDYLVQTTTYLPENFTYSPYLPCPEKLPYMRGFLNVNVSEVSFDEIHQLFSKDLDIEPGGHWRPKDCKPRWKVAVLIPFRNRHEHLPIFFLHLIPMLQKQRLEFAFYVIEQTGTQPFNRAMLFNVGFKEAMKDSVWDCVIFHDVDHLPENDRNYYGCGEMPRHFAAKLDKYMYILPYKEFFGGVSGLTVEQFRKINGFPNAFWGWGGEDDDLWNRVHYAGYNVTRPEGDLGKYKSIPHHHRGEVQFLGRYKLLRYSKERQYIDGLNNLIYRPKILVDRLYTNISVNLMPELAPIEDY

• Full Name: UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 6
• Calculated Molecular Weight: 382 aa, 45 kDa
• Observed Molecular Weight: 45-60 kDa
• GenBank Accession Number: BC074884
• Gene Symbol: B4GALT6
• Gene ID (NCBI): 9331
• RRID: AB_10665357
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UBX8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Beta-1,4-galactosyltransferase 6 (B4GALT6) is a member of the beta 4-galactosyltransferase family that catalyzes the biosynthesis of glycosphingolipids in UDP-dependent manner (PMID: 23744354). B4GALT6 in astrocytes boosts CNS inflammation and promote neurodegeneration during chronic CNS inflammation (PMID: 25216636).