Rat CD86 Recombinant monoclonal antibody, PBS Only (Detector)

• 

  WB analysis using 86252-1-RR (same clone as 86252-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86252-1-RR (CD86 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86252-1-PBS in a different storage buffer formulation.

• 

  Cytometric bead array sample test of MP02379-1

  The mean CD86 concentration was determined to be 105.1 ng/mL in Rat spleen tissue extract based on a 8.8 mg/mL extract load.

• 

  Cytometric bead array standard curve of MP02379-1

  Cytometric bead array standard curve of MP02379-1, RAT CD86 Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 86252-2-PBS. Detection antibody: 86252-1-PBS. Standard: Eg3586. Range: 0.312-40 ng/mL.

CD86 Uni-rAb^® Recombinant Antibody for WB, Cytometric bead array, Indirect ELISA

Cat No. 86252-1-PBS

Clone No.250726D3

Host / Isotype

Rabbit / IgG

Reactivity

rat

Applications

WB, Cytometric bead array, Indirect ELISA

Synonyms

B7 2, B7-2, CD86 molecule

---

Product Information

86252-1-PBS targets CD86 as part of a matched antibody pair:

MP02379-1: 86252-2-PBS capture and 86252-1-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg3586

  Product name: Recombinant Rat CD86 protein (rFc Tag) (HPLC verified)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 30-248 aa of NM_020081.1

  Sequence: PVKRQAYFNSTAYLPCPFTKAQNISPSELVVFWQDRKKSVLYEHYLGAEKLDNVNAKYLGRTSFDRDNQALRLHNVQIKDTGLYDCFIQQKTPTGSIILQQWETELSVIANFSEPEIEEAQNETRNTGINLTCSSKQGYPKPTKMYFLITNSTNEYGDNMQISQDNVTKLFSVSISLSLPFPDGVYNMTIVCILETESMNISSKPHNMVFSQPQFDRKT

• Full Name: CD86 molecule
• Calculated Molecular Weight: 36 kDa
• Observed Molecular Weight: 70-75 kDa
• GenBank Accession Number: NM_020081.1
• Gene Symbol: Cd86
• Gene ID (NCBI): 56822
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O35531
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CD86 (also known as B7-2) is a costimulatory molecule belonging to the immunoglobulin superfamily. Primarily expressed on antigen-presenting cells (APCs), including B cells, dendritic cells, and macrophages, CD86 is the ligand for two proteins at the cell surface of T cells, CD28 antigen and CTLA-4. Binding of CD86 with CD28 antigen is a costimulatory signal for activation of the T-cell. Binding of CD86 with CTLA-4 negatively regulates T-cell activation and diminishes the immune response. (PMID: 7513726; 1847722; 11029388; 27591335)