• Zero Fc receptor binding
  • Site-specific conjugation
  • One universal isotype

FcZero-rAb® APC Anti-Human B7-H3/CD276 Rabbit Recombinant Antibody

B7-H3/CD276 FcZero-rAb® Recombinant Antibody for FC

Cat No. APC-FcA98017
Clone No.230305A10

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC

CD276, 230305A10, 4Ig-B7-H3, B7 H3, B7 homolog 3

Formulation:  PBS, Azide, BSA
PBS, Azide, BSA
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC detected inhuman monocyte-derived immature dendritic cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC)FC : 5 ul per 10^6 cells in 100 μl suspension
This reagent has been pre-titrated and tested for flow cytometric analysis. The suggested use of this reagent is 5 ul per 10^6 cells in a 100 µl suspension or 5 ul per 100 µl of whole blood.
Sample-dependent, Check data in validation data gallery.

Product Information

APC-FcA98017 targets B7-H3/CD276 in FC applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg0075

Product name: Recombinant Human B7-H3/CD276 protein (Myc Tag, His Tag)

Source: mammalian cells-derived, pHZ-KIsec

Tag: Myc & 6*His

Domain: 29-245 aa of NM_001024736

Sequence: LEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFP

Predict reactive species
Full Name CD276 molecule
Calculated Molecular Weight57 kDa
GenBank Accession NumberNM_001024736
Gene Symbol CD276
Gene ID (NCBI) 80381
Conjugate APC Fluorescent Dye
Excitation/Emission Maxima Wavelengths650 nm / 660 nm
Excitation LaserRed Laser (633 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ5ZPR3
Storage Buffer PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.
Storage ConditionsStore at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

B7-H3 (CD276) is a type I transmembrane protein expressed on many tissues and cell types. B7-H3 is a 100-kDa glycoprotein that belongs to the B7 immunoregulatory family and participates in the regulation of T-cell-mediated immune response probably by functioning as both a T cell costimulator and coinhibitor (PMID: 25567370; 20696859). Overexpressed on a wide range of human solid cancers, B7-H3 has been implicated in cancer progression and metastasis and becomes an attractive target for cancer immunotherapy (PMID: 27208063).

Protocols

Product Specific Protocols
FC protocol for APC B7-H3/CD276 antibody APC-FcA98017Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...