FITC Plus Anti-Human B7-H3/CD276 Rabbit Recombinant Antibody

• Home
• Products
• Primary Antibodies
• Flow Cytometry Antibodies
• FITC Plus Anti-Human B7-H3/CD276 Rabbit Recombinant Antibody (FITC-98017)

B7-H3/CD276 Uni-rAb^® Recombinant Antibody for FC

Cat No. FITC-98017 Copied!

Clone No. 230305A10

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC

Synonyms

CD276, 230305A10, 4Ig-B7-H3, B7 H3, B7 homolog 3

• 

  FC experiment of human monocyte-derived immature dendritic cells using FITC-98017

  1x10^6 unstimulated or stimulated human monocyte-derived immature dendritic cells were surface stained with 5 ul FITC Plus Anti-Human B7-H3/CD276 Rabbit RecAb (FITC-98017, Clone: 230305A10). Cells were not fixed.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of human monocyte-derived immature dendritic cells using FITC-98017

  1x10^6 stimulated human monocyte-derived immature dendritic cells were surface stained with 5 ul FITC Plus Anti-Human B7-H3/CD276 Rabbit RecAb (FITC-98017, Clone: 230305A10) (red) or FITC Plus Rabbit IgG Isotype Control Recombinant Antibody (FITC-98136, Clone: 240953C9) (blue). 1x10^6 unstimulated human monocyte-derived immature dendritic cells were surface stained with 5 ul FITC Plus Anti-Human B7-H3/CD276 Rabbit RecAb (FITC-98017, Clone: 230305A10) (black, dashed). Cells were not fixed.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for B7-H3/CD276 in ?

Chat with Able

---

Tested Applications

• Positive FC detected in: human monocyte-derived immature dendritic cells

Recommended dilution

• Flow Cytometry (FC): FC : 5 ul per 10^6 cells in a 100 µl suspension

This reagent has been pre-titrated and tested for flow cytometric analysis. The suggested use of this reagent is 5 ul per 10^6 cells in a 100 µl suspension or 5 ul per 100 µl of whole blood.

Sample-dependent, Check data in validation data gallery.

Product Information

FITC-98017 targets B7-H3/CD276 in FC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg0075

  Product name: Recombinant Human B7-H3/CD276 protein (Myc Tag, His Tag)

  Source: mammalian cells-derived, pHZ-KIsec

  Tag: Myc & 6*His

  Domain: 29-245 aa of NM_001024736

  Sequence: LEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFP

• Full Name: CD276 molecule
• Calculated Molecular Weight: 57 kDa
• GenBank Accession Number: NM_001024736
• Gene Symbol: CD276
• Gene ID (NCBI): 80381
• Conjugate: FITC Plus Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 495 nm / 524 nm
• Excitation Laser: Blue laser (488 nm)
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q5ZPR3
• Storage Buffer: PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.
• Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

B7-H3 (CD276) is a type I transmembrane protein expressed on many tissues and cell types. B7-H3 is a 100-kDa glycoprotein that belongs to the B7 immunoregulatory family and participates in the regulation of T-cell-mediated immune response probably by functioning as both a T cell costimulator and coinhibitor (PMID: 25567370; 20696859). Overexpressed on a wide range of human solid cancers, B7-H3 has been implicated in cancer progression and metastasis and becomes an attractive target for cancer immunotherapy (PMID: 27208063).