B7‑H4 Monoclonal antibody, PBS Only

• 

  WB analysis using 66817-1-Ig (same clone as 66817-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66817-1-Ig (B7‑H4 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66817-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human cervical cancer using 66817-1-Ig (same clone as 66817-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 66817-1-Ig (B7‑H4 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66817-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse colon using 66817-1-Ig (same clone as 66817-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 66817-1-Ig (B7‑H4 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66817-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat kidney using 66817-1-Ig (same clone as 66817-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat kidney tissue slide using 66817-1-Ig (B7‑H4 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66817-1-PBS in a different storage buffer formulation.

B7‑H4 Monoclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 66817-1-PBS

Clone No.2E5B1

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

VTCN1, B7-H4, B7H4, B7h.5, B7 homolog 4

---

Product Information

66817-1-PBS targets B7‑H4 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27751

  Product name: Recombinant human VTCN1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-187 aa of BC065717

  Sequence: MFRGRTAVFADQVIVGNASLRLKNVQLTDAGTYKCYIITSKGKGNANLEYKTGAFSMPEVNVDYNASSETLRCEAPRWFPQPTVVWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTESEIKRRSHLQLLNSKASLCVSSFFAISWALLPLSPYLMLK

• Full Name: V-set domain containing T cell activation inhibitor 1
• Calculated Molecular Weight: 282 aa, 31 kDa
• Observed Molecular Weight: 31-35 kDa
• GenBank Accession Number: BC065717
• Gene Symbol: B7-H4
• Gene ID (NCBI): 79679
• RRID: AB_2882160
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q7Z7D3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

B7‑H4 also named VTCN1, B7X, or B7S1 is a 282 amino acid protein, which contains 2 immunoglobulin-like domains and belongs to the immunoglobulin superfamily. B7‑H4 negatively regulates T-cell mediated immune response by inhibiting T-cell activation, proliferation, cytokine production and development of cytotoxicity. B7‑H4 is a single-pass type I membrane protein, which is over-expressed in breast, ovarian, endometrial, renal cell and non-small-cell lung cancers. The predicted molecular weight of B7‑H4 is 31 kDa. The glycosylated B7‑H4 is 50 to 80 kDa, and the non-glycosylated form is 28 kDa.