B7‑H4 Monoclonal antibody

• 

  WB analysis using 66817-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 66817-1-Ig (B7‑H4 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human cervical cancer using 66817-1-Ig

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 66817-1-Ig (B7‑H4 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse colon using 66817-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 66817-1-Ig (B7‑H4 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat kidney using 66817-1-Ig

  Immunohistochemical analysis of paraffin-embedded rat kidney tissue slide using 66817-1-Ig (B7‑H4 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

B7‑H4 Monoclonal Antibody for WB, IHC, ELISA

Cat No. 66817-1-Ig

Clone No.2E5B1

Publications(1)

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

VTCN1, B7-H4, B7H4, B7h.5, B7 homolog 4

---

Tested Applications

• Positive WB detected in: SKOV-3 cells, T-47D cells, HeLa cells, A549 cells
• Positive IHC detected in: rat kidney tissue, human cervical cancer tissue, mouse colon tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• IHC: See 1 publications below

Product Information

66817-1-Ig targets B7‑H4 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27751

  Product name: Recombinant human VTCN1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-187 aa of BC065717

  Sequence: MFRGRTAVFADQVIVGNASLRLKNVQLTDAGTYKCYIITSKGKGNANLEYKTGAFSMPEVNVDYNASSETLRCEAPRWFPQPTVVWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTESEIKRRSHLQLLNSKASLCVSSFFAISWALLPLSPYLMLK

• Full Name: V-set domain containing T cell activation inhibitor 1
• Calculated Molecular Weight: 282 aa, 31 kDa
• Observed Molecular Weight: 31-35 kDa
• GenBank Accession Number: BC065717
• Gene Symbol: B7-H4
• Gene ID (NCBI): 79679
• RRID: AB_2882160
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q7Z7D3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

B7‑H4 also named VTCN1, B7X, or B7S1 is a 282 amino acid protein, which contains 2 immunoglobulin-like domains and belongs to the immunoglobulin superfamily. B7‑H4 negatively regulates T-cell mediated immune response by inhibiting T-cell activation, proliferation, cytokine production and development of cytotoxicity. B7‑H4 is a single-pass type I membrane protein, which is over-expressed in breast, ovarian, endometrial, renal cell and non-small-cell lung cancers. The predicted molecular weight of B7‑H4 is 31 kDa. The glycosylated B7‑H4 is 50 to 80 kDa, and the non-glycosylated form is 28 kDa.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IHC	Cancer Lett; The deubiquitinase USP2a promotes tumor immunosuppression by stabilizing immune checkpoint B7-H4 in lung adenocarcinoma harboring EGFR-activating mutants; Authors - Youwei Lu