Anti-Rat B7-H4 Rabbit Recombinant Antibody

• Home
• Products
• Primary Antibodies
• Flow Cytometry Antibodies
• Anti-Rat B7-H4 Rabbit Recombinant Antibody (98552-2-RR)

B7-H4 Uni-rAb^® Recombinant Antibody for FC

Cat No. 98552-2-RR Copied!

Clone No. 250392E12

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

rat

Applications

FC

Synonyms

B7H4, B7S1, B7x, V-set domain-containing T-cell activation inhibitor 1, Vtcn1

• 

  FC experiment of Transfected HEK-293T using 98552-2-RR

  1x10^6 HEK-293T cells (left) or B7-H4 transfected HEK-293T cells (right) were surface stained with 0.25 ug Anti-Rat B7-H4 Rabbit RecAb (98552-2-RR, Clone: 250392E12) and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were not fixed.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of Transfected HEK-293T using 98552-2-RR

  1x10^6 HEK-293T cells (left) or B7-H4 transfected HEK-293T cells (right) were surface stained with 0.25 ug Anti-Rat B7-H4 Rabbit RecAb (98552-2-RR, Clone:250392E12) (red) or Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were not fixed.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for B7-H4 in ?

Chat with Able

---

Tested Applications

• Positive FC detected in: Transfected HEK-293T cells

Recommended dilution

• Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension

This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

98552-2-RR targets B7-H4 in FC applications and shows reactivity with rat samples.

• Tested Reactivity: rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg3230

  Product name: Recombinant Rat B7-H4 protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 29-257 aa of NM_001024244.1

  Sequence: FGISGKHFITVTTFTSAGNIGEDGTLSCTFEPDIKLNGIVIQWLKEGIKGLVHEFKEGKDDLSQQHEMFRGRTAVFADQVVVGNASLRLKNVQLTDAGTYTCYIHTSKGKGNANLEYKTGAFSMPEINVDYNASSESLRCEAPRWFPQPTVAWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTDSEVKRRSQLELLNSG

• Full Name: V-set domain containing T cell activation inhibitor 1
• Calculated Molecular Weight: 31 kDa
• GenBank Accession Number: NM_001024244.1
• Gene Symbol: Vtcn1
• Gene ID (NCBI): 295322
• RRID: AB_3746172
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q501W4
• Storage Buffer: PBS with 0.09% sodium azide, pH 7.3.
• Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.

Background Information

B7-H4, also named VTCN1, B7X, or B7S1, is a single-pass type I membrane protein, which contains two immunoglobulin-like domains and belongs to the immunoglobulin superfamily. B7-H4 negatively regulates T-cell mediated immune response by inhibiting T-cell activation, proliferation, cytokine production and development of cytotoxicity. B7-H4 is over-expressed in many cancers, including breast, ovarian, endometrial, renal cell and non-small-cell lung cancers.