B7-H6 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• B7-H6 Polyclonal antibody, PBS Only (27428-1-PBS)

• 

  WB analysis of HEK-293 using 27428-1-AP (same clone as 27428-1-PBS)

  WB result of B7-H6 antibody (27428-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-B7-H6 transfected HEK-293 cells. This data was developed using the same antibody clone with 27428-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 27428-1-AP (same clone as 27428-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 27428-1-AP (B7H6 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27428-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

B7-H6 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 27428-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

B7H6, NCR3LG1, B7 H6, B7 homolog 6, Natural cytotoxicity triggering receptor 3 ligand 1

---

Product Information

27428-1-PBS targets B7-H6 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26532

  Product name: Recombinant human DKFZp686O24166 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 25-259 aa of BC136800

  Sequence: DLKVEMMAGGTQITPLNDNVTIFCNIFYSQPLNITSMGITWFWKSLTFDKEVKVFEFFGDHQEAFRPGAIVSPWRLKSGDASLRLPGIQLEEAGEYRCEVVVTPLKAQGTVQLEVVASPASRLLLDQVGMKENEDKYMCESSGFYPEAINITWEKQTQKFPHPIEISEDVITGPTIKNMDGTFNVTSCLKLNSSQEDPGTVYQCVVRHASLHTPLRSNFTLTAARHSLSETEKTD

• Full Name: hypothetical protein DKFZp686O24166
• Calculated Molecular Weight: 51 kDa
• Observed Molecular Weight: 75-80 kDa
• GenBank Accession Number: BC136800
• Gene Symbol: B7H6
• Gene ID (NCBI): 374383
• RRID: AB_3085956
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q68D85
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

B7-H6, also known as NCR3LG1, is a member of the B7 family of immunoreceptors. It is a 454-aa-long type I transmembrane protein consisting of an extracellular region, a transmembrane segment, and a cytoplasmic domain which contains an immunoreceptor tyrosine-based inhibitory motif (ITIM), an SH2-binding domain, and an SH3-binding motif. B7-H6 triggers NKp30-mediated activation of human NK cells (PMID: 19528259). It has been reported that B7H6 is expressed in various types of tumor cells and plays a prominent role in natural killer cell immunosurveillance (PMID: 35697295). The apparent molecular weight of B7-H6 is larger than the calculated molecular weight of 51 kDa due to glycosylation (PMID: 19528259).