BAF170 Recombinant monoclonal antibody, PBS Only

BAF170 Uni-rAb® Recombinant Antibody for WB, Indirect ELISA
Cat No. 86473-3-PBS
Clone No.251330D11

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

SMARCC2, BRG1-associated factor 170, CRACC2, Rsc8, SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily C member 2

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

86473-3-PBS targets BAF170 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag2634

Product name: Recombinant human BAF170 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 300-647 aa of BC013045

Sequence: KRSPSPSPTPEAKKKNAKKGPSTPYTKSKRGHREEEQEDLTKDMDEPSPVPNVEEVTLPKTVNTKKDSESAPVKGGTMTDLDEQEDESMETTGKDEDENSTGNKGEQTKNPDLHEDNVTEQTHHIIIPSYAAWFDYNSVHAIERRALPEFFNGKNKSKTPEIYLAYRNFMIDTYRLNPQEYLTSTACRRNLAGDVCAIMRVHAFLEQWGLINYQVDAESRPTPMGPPPTSHFHVLADTPSGLVPLQPKTPQGRQVDADTKAGRKGKELDDLVPETAKGKPELQTSASQQMLNFPDKGKEKPTDMQNFGLRTDMYTKKNVPSKSKAAASATREWTEQETLLLLEALEMY

Predict reactive species
Full Name SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 2
Calculated Molecular Weight 1214 aa, 132 kDa
Observed Molecular Weight170 kDa
GenBank Accession NumberBC013045
Gene Symbol BAF170
Gene ID (NCBI) 6601
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ8TAQ2
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

BAF170, also named as SWI/SNF complex 170 kDa subunit or SMARCC2, is a 1214 amino acid protein, which belongs to the SMARCC family. BAF170 is ubiquitously expressed. BAF170 is involved in transcriptional activation and repression of select genes by chromatin remodeling. BAF170 may be required for CoREST dependent repression of neuronal specific gene promoters in non-neuronal cells. BAF170 belongs to the neural progenitors-specific chromatin remodeling complex (npBAF complex) and the neuron-specific chromatin remodeling complex (nBAF complex). The calcualted molecular weight of BAF170, is 133 kDa, but modified BAF170 is about 170 kDa. (PMID: 8804307)

Loading...
||
New chat Able
正在加载,请稍候...