BAF170 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 86473-3-RR (same clone as 86473-3-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86473-3-RR (BAF170 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86473-3-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 86473-3-RR

  Biolayer interferometry (BLl) kinetic assays of 86473-3-RR against Human BAF170 were performed. The affinity constant is 4.64 nM.

BAF170 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 86473-3-PBS

Clone No.251330D11

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

SMARCC2, BRG1-associated factor 170, CRACC2, Rsc8, SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily C member 2

---

Product Information

86473-3-PBS targets BAF170 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag2634

  Product name: Recombinant human BAF170 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 300-647 aa of BC013045

  Sequence: KRSPSPSPTPEAKKKNAKKGPSTPYTKSKRGHREEEQEDLTKDMDEPSPVPNVEEVTLPKTVNTKKDSESAPVKGGTMTDLDEQEDESMETTGKDEDENSTGNKGEQTKNPDLHEDNVTEQTHHIIIPSYAAWFDYNSVHAIERRALPEFFNGKNKSKTPEIYLAYRNFMIDTYRLNPQEYLTSTACRRNLAGDVCAIMRVHAFLEQWGLINYQVDAESRPTPMGPPPTSHFHVLADTPSGLVPLQPKTPQGRQVDADTKAGRKGKELDDLVPETAKGKPELQTSASQQMLNFPDKGKEKPTDMQNFGLRTDMYTKKNVPSKSKAAASATREWTEQETLLLLEALEMY

• Full Name: SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 2
• Calculated Molecular Weight: 1214 aa, 132 kDa
• Observed Molecular Weight: 170 kDa
• GenBank Accession Number: BC013045
• Gene Symbol: BAF170
• Gene ID (NCBI): 6601
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q8TAQ2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

BAF170, also named as SWI/SNF complex 170 kDa subunit or SMARCC2, is a 1214 amino acid protein, which belongs to the SMARCC family. BAF170 is ubiquitously expressed. BAF170 is involved in transcriptional activation and repression of select genes by chromatin remodeling. BAF170 may be required for CoREST dependent repression of neuronal specific gene promoters in non-neuronal cells. BAF170 belongs to the neural progenitors-specific chromatin remodeling complex (npBAF complex) and the neuron-specific chromatin remodeling complex (nBAF complex). The calcualted molecular weight of BAF170, is 133 kDa, but modified BAF170 is about 170 kDa. (PMID: 8804307)