BAF170 Recombinant monoclonal antibody

• 

  WB analysis using 86473-3-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 86473-3-RR (BAF170 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  Affinity and Kinetic Characterization of 86473-3-RR

  Biolayer interferometry (BLl) kinetic assays of 86473-3-RR against Human BAF170 were performed. The affinity constant is 4.64 nM.

BAF170 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 86473-3-RR

Clone No.251330D11

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

SMARCC2, BRG1-associated factor 170, CRACC2, Rsc8, SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily C member 2

---

Tested Applications

• Positive WB detected in: LNCaP cells, A431 cells, HeLa cells, RAW 264.7 cells, C6 cells, NIH/3T3 cells, PC-12 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

86473-3-RR targets BAF170 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag2634

  Product name: Recombinant human BAF170 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 300-647 aa of BC013045

  Sequence: KRSPSPSPTPEAKKKNAKKGPSTPYTKSKRGHREEEQEDLTKDMDEPSPVPNVEEVTLPKTVNTKKDSESAPVKGGTMTDLDEQEDESMETTGKDEDENSTGNKGEQTKNPDLHEDNVTEQTHHIIIPSYAAWFDYNSVHAIERRALPEFFNGKNKSKTPEIYLAYRNFMIDTYRLNPQEYLTSTACRRNLAGDVCAIMRVHAFLEQWGLINYQVDAESRPTPMGPPPTSHFHVLADTPSGLVPLQPKTPQGRQVDADTKAGRKGKELDDLVPETAKGKPELQTSASQQMLNFPDKGKEKPTDMQNFGLRTDMYTKKNVPSKSKAAASATREWTEQETLLLLEALEMY

• Full Name: SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 2
• Calculated Molecular Weight: 1214 aa, 132 kDa
• Observed Molecular Weight: 170 kDa
• GenBank Accession Number: BC013045
• Gene Symbol: BAF170
• Gene ID (NCBI): 6601
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q8TAQ2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

BAF170, also named as SWI/SNF complex 170 kDa subunit or SMARCC2, is a 1214 amino acid protein, which belongs to the SMARCC family. BAF170 is ubiquitously expressed. BAF170 is involved in transcriptional activation and repression of select genes by chromatin remodeling. BAF170 may be required for CoREST dependent repression of neuronal specific gene promoters in non-neuronal cells. BAF170 belongs to the neural progenitors-specific chromatin remodeling complex (npBAF complex) and the neuron-specific chromatin remodeling complex (nBAF complex). The calcualted molecular weight of BAF170, is 133 kDa, but modified BAF170 is about 170 kDa. (PMID: 8804307)