Mouse BAFF Recombinant monoclonal antibody, PBS Only (Capture)

BAFF Uni-rAb® Recombinant Antibody for Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test
Cat No. 84541-1-PBS
Clone No.242006D4

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

B-cell-activating factor, CD257, Tnfsf13b, Tumor necrosis factor ligand superfamily member 13B, Tumor necrosis factor ligand superfamily member 13b, membrane form

Formulation:  PBS Only
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84541-1-PBS targets BAFF as part of a matched antibody pair:

MP01378-1: 84541-1-PBS capture and 84541-2-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg1555

Product name: Recombinant Mouse BAFF protein (rFc Tag)

Source: mammalian cells-derived, pHZ-KIsec-N-rFc

Tag: N-rFc

Domain: 127-309 aa of NM_033622

Sequence: AFQGPEETEQDVDLSAPPAPCLPGCRHSQHDDNGMNLRNIIQDCLQLIADSDTPTIRKGTYTFVPWLLSFKRGNALEEKENKIVVRQTGYFFIYSQVLYTDPIFAMGHVIQRKKVHVFGDELSLVTLFRCIQNMPKTLPNNSCYSAGIARLEEGDEIQLAIPRENAQISRNGDDTFFGALKLL

Predict reactive species
Full Name tumor necrosis factor (ligand) superfamily, member 13b
Calculated Molecular Weight34kd
GenBank Accession NumberNM_033622
Gene Symbol Tnfsf13b
Gene ID (NCBI) 24099
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9WU72
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.
Loading...
||
New chat Able
正在加载,请稍候...