BAIAP2L2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• BAIAP2L2 Polyclonal antibody, PBS Only (16738-1-PBS)

• 

  WB analysis using 16738-1-AP (same clone as 16738-1-PBS)

  HT-29 cells were subjected to SDS PAGE followed by western blot with 16738-1-AP (BAIAP2L2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16738-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human intrahepatic cholangiocarcinoma using 16738-1-AP (same clone as 16738-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human intrahepatic cholangiocarcinoma tissue slide using 16738-1-AP (BAIAP2L2 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16738-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human intrahepatic cholangiocarcinoma using 16738-1-AP (same clone as 16738-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human intrahepatic cholangiocarcinoma tissue slide using 16738-1-AP (BAIAP2L2 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16738-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

BAIAP2L2 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 16738-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

UNQ9336/PRO34007, Planar intestinal- and kidney-specific BAR domain protein, Pinkbar, Brain-specific angiogenesis inhibitor 1-associated protein 2-like protein 2, BAR/IMD domain-containing adapter protein 2-like 2

---

Product Information

16738-1-PBS targets BAIAP2L2 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9904

  Product name: Recombinant human BAIAP2L2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 168-518 aa of BC015619

  Sequence: FVSESQRAAELEEKRRYRFLAEKHLLLSNTFLQFFGRARGMLQNRVLLWKEQSEASRSPSRAHSPGLLGPALGPPYPSGRLTPTRLDMPPRPLGEFSSPRSRHGSGSYGTEPDARPASQLEPDRRSLPRTPSASSLYSGSAQSSRSNSFGERPGGGGGARRVRALVSHSEGANHTLLRFSAGDVVEVLVPEAQNGWLYGKLEGSSASGWFPEAYVKALEEGPVNPMTPVTPMTSMTSMSPMTPMTPMNPGNELPSRSYPLRGSHSLDDLLDRPGNSTPSRVPSRAPSPAPPPLPSSRRSSMGSTAVATDVKKLMSSEQYPPQELFPRGTNPFATVKLRPTITNDRSAPLIR

• Full Name: BAI1-associated protein 2-like 2
• Calculated Molecular Weight: 518 aa, 58 kDa
• Observed Molecular Weight: 57 kDa
• GenBank Accession Number: BC015619
• Gene Symbol: BAIAP2L2
• Gene ID (NCBI): 80115
• RRID: AB_2878309
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6UXY1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.