CoraLite® Plus 488-conjugated BAP31 Recombinant monoclonal antibody

BAP31 Uni-rAb® Recombinant Antibody for IF/ICC
Cat No. CL488-84584-5
Clone No.241978D10

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC

BCAP31, 241978D10, 6C6 AG, 6C6-AG tumor-associated antigen, B-cell receptor-associated protein 31

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-84584-5 targets BAP31 in IF/ICC applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag1668

Product name: Recombinant human BCAP31 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-246 aa of BC014323

Sequence: MSLQWTAVATFLYAEVFVVLLLCIPFISPKRWQKIFKSRLVELLVSYGNTFFVVLIVILVLLVIDAVREIREYDDVTEKVNLQNNPGAMEHFHMKLFRAQRNLYIAGFSLLLSFLLRRLVTLISQQATLLASNEAFKKQAESASEAAKKYMEENDQLKKGAAVDGGKLDVGNAEVKLEEENRSLKADLQKLKDELASTKQKLEKAENQVLAMRKQSEGLTKEYDRLLEEHAKLQAAVDGPMDKKEE

Predict reactive species
Full Name B-cell receptor-associated protein 31
Calculated Molecular Weight 28 kDa
Observed Molecular Weight 28 kDa
GenBank Accession NumberBC014323
Gene Symbol BAP31
Gene ID (NCBI) 10134
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP51572
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

BAP31, also known as BCAP31, is a chaperone protein abundant in the endoplasmic reticulum (ER). BAP31 plays a role in the export of secreted proteins in the ER, the recognition of abnormally folded proteins, and their targeting to the ER-associated-degradation (ERAD). CDIP1 and BAP31 interact upon ER stress to regulate the mitochondrial apoptosis pathway(PMID: 24139803). It also serves as a cargo receptor for the export of transmembrane proteins. BAP31 may be involved in apoptosis.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 BAP31 antibody CL488-84584-5Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...