BARHL2 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 83596-4-RR (same clone as 83596-4-PBS)

  mouse cerebellum tissue were subjected to SDS PAGE followed by western blot with 83596-4-RR (BARHL2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83596-4-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 83596-4-RR (same clone as 83596-4-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using BARHL2 antibody (83596-4-RR, Clone: 240558G8 ) at dilution of 1:250 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 83596-4-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 83596-4-RR (same clone as 83596-4-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using BARHL2 antibody (83596-4-RR, Clone: 240558G8 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 83596-4-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 83596-4-RR

  Biolayer interferometry (BLl) kinetic assays of 83596-4-RR against Human BARHL2 were performed. The affinity constant is 0.478 nM.

BARHL2 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 83596-4-PBS

Clone No.240558G8

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

240558G8, BarH like 2 homeobox protein, BarH-like 2 homeobox protein

---

Product Information

83596-4-PBS targets BARHL2 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag21156

  Product name: Recombinant human BARHL2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-141 aa of BC126439

  Sequence: MTMEGASGSSFGIDTILSSASSGSPGMMNGDFRPLGEARTADFRSQATPSPCSEIDTVGTAPSSPISVTMEPPEPHLVADATQHHHHLHHSQQPPPPAAAPTQSLQPLPQQQQPLPPQQPPPPPPQQLGSAASAPRTSTSS

• Full Name: BarH-like homeobox 2
• Calculated Molecular Weight: 387 aa, 42 kDa
• Observed Molecular Weight: 42 kDa
• GenBank Accession Number: BC126439
• Gene Symbol: BARHL2
• Gene ID (NCBI): 343472
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9NY43
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

BARHL2 also named as BarH like homeobox 2 is 279 amino acid protein, which contains 1 homeobox DNA-binding domain. BARHL2 localizes in nucleus and belongs to BAR homeobox family. BARHL2 as a transcription factor binds optimally to the DNA consensus sequence. Barx2 may differentially control the expression of L1 and other target genes during embryonic development. Barx2 is expressed in several smooth muscle-containing tissues, as well as skeletal muscle, brain, tongue and esophagus.