BARHL2 Recombinant monoclonal antibody, PBS Only (Detector)

BARHL2 Uni-rAb® Recombinant Antibody for WB, IF/ICC, Cytometric bead array, Indirect ELISA
Cat No. 83596-4-PBS
Clone No.240558G8

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, Cytometric bead array, Indirect ELISA

240558G8, BarH like 2 homeobox protein, BarH-like 2 homeobox protein

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83596-4-PBS targets BARHL2 as part of a matched antibody pair:

MP00582-2: 83596-1-PBS capture and 83596-4-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag21156

Product name: Recombinant human BARHL2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-141 aa of BC126439

Sequence: MTMEGASGSSFGIDTILSSASSGSPGMMNGDFRPLGEARTADFRSQATPSPCSEIDTVGTAPSSPISVTMEPPEPHLVADATQHHHHLHHSQQPPPPAAAPTQSLQPLPQQQQPLPPQQPPPPPPQQLGSAASAPRTSTSS

Predict reactive species
Full Name BarH-like homeobox 2
Calculated Molecular Weight 387 aa, 42 kDa
Observed Molecular Weight 42 kDa
GenBank Accession NumberBC126439
Gene Symbol BARHL2
Gene ID (NCBI) 343472
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9NY43
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

BARHL2 also named as BarH like homeobox 2 is 279 amino acid protein, which contains 1 homeobox DNA-binding domain. BARHL2 localizes in nucleus and belongs to BAR homeobox family. BARHL2 as a transcription factor binds optimally to the DNA consensus sequence. Barx2 may differentially control the expression of L1 and other target genes during embryonic development. Barx2 is expressed in several smooth muscle-containing tissues, as well as skeletal muscle, brain, tongue and esophagus.

Loading...
||
New chat Able
正在加载,请稍候...