BASP1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• BASP1 Polyclonal antibody, PBS Only (14880-1-PBS)

BASP1 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 14880-1-PBS Copied!

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

22 kDa neuronal tissue-enriched acidic protein, Brain acid soluble protein 1, CAP 23, CAP23, NAP 22

• 

  WB analysis using 14880-1-AP (same clone as 14880-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 14880-1-AP (BASP1 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14880-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human skin cancer using 14880-1-AP (same clone as 14880-1-PBS)

  Immunohistochemical analysis of paraffin-embedded skin cancer slide using 14880-1-AP (BASP1 antibody) at dilution of 1:1600 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 14880-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human skin cancer using 14880-1-AP (same clone as 14880-1-PBS)

  Immunohistochemical analysis of paraffin-embedded skin cancer slide using 14880-1-AP (BASP1 antibody) at dilution of 1:1600 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 14880-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 14880-1-AP (same clone as 14880-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 14880-1-AP (BASP1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 14880-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for BASP1 in ?

Chat with Able

---

Product Information

14880-1-PBS targets BASP1 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6653

  Product name: Recombinant human BASP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-227 aa of BC000518

  Sequence: MGGKLSKKKKGYNVNDEKAKEKDKKAEGAATEEEGTPKESEPQAAAEPAEAKEGKEKPDQDAEGKAEEKEGEKDAAAAKEEAPKAEPEKTEGAAEAKAEPPKAPEQEQAAPGPAAGGEAPKAAEAAAAPAESAAPAAGEEPSKEEGEPKKTGAPAAPAAQETKSDGAPASDSKPGSSEAAPSSKETPAATEAPSSTPKAQGPAASAEEPKPVEAPAANSDQTVTVKE

• Full Name: brain abundant, membrane attached signal protein 1
• Calculated Molecular Weight: 23 kDa
• Observed Molecular Weight: 55-60 kDa
• GenBank Accession Number: BC000518
• Gene Symbol: BASP1
• Gene ID (NCBI): 10409
• RRID: AB_3085444
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P80723
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

BASP1 (brain acid-soluble protein 1), also known as NAP22 or CAP-23, is an evolutionarily conserved intrinsically disordered protein that participates in cell signaling, migration, apoptosis, and gene transcription. It is highly expressed in the nervous system and plays roles in neurodevelopment, synaptic function, and nerve regeneration. BASP1 exhibits context-dependent functions in disease: it acts as a tumor suppressor in gastric cancer by inhibiting the Wnt/β-catenin pathway and in acute myeloid leukemia, while promoting atherosclerosis via vascular smooth muscle cell proliferation and inflammation. It has emerged as a promising therapeutic target and diagnostic biomarker. (PMID: 33426068; 41415108; 33015061)