BASP1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• BASP1 Polyclonal antibody, PBS Only (14880-1-PBS)

• 

  WB analysis using 14880-1-AP (same clone as 14880-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 14880-1-AP (BASP1 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14880-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 14880-1-AP (same clone as 14880-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 14880-1-AP (BASP1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 14880-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human skin cancer using 14880-1-AP (same clone as 14880-1-PBS)

  Immunohistochemical analysis of paraffin-embedded skin cancer slide using 14880-1-AP (BASP1 antibody) at dilution of 1:1600 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 14880-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human skin cancer using 14880-1-AP (same clone as 14880-1-PBS)

  Immunohistochemical analysis of paraffin-embedded skin cancer slide using 14880-1-AP (BASP1 antibody) at dilution of 1:1600 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 14880-1-PBS in a different storage buffer formulation.

BASP1 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 14880-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

22 kDa neuronal tissue-enriched acidic protein, Brain acid soluble protein 1, CAP 23, CAP23, NAP 22

---

Product Information

14880-1-PBS targets BASP1 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6653

  Product name: Recombinant human BASP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-227 aa of BC000518

  Sequence: MGGKLSKKKKGYNVNDEKAKEKDKKAEGAATEEEGTPKESEPQAAAEPAEAKEGKEKPDQDAEGKAEEKEGEKDAAAAKEEAPKAEPEKTEGAAEAKAEPPKAPEQEQAAPGPAAGGEAPKAAEAAAAPAESAAPAAGEEPSKEEGEPKKTGAPAAPAAQETKSDGAPASDSKPGSSEAAPSSKETPAATEAPSSTPKAQGPAASAEEPKPVEAPAANSDQTVTVKE

• Full Name: brain abundant, membrane attached signal protein 1
• Calculated Molecular Weight: 23 kDa
• Observed Molecular Weight: 55-60 kDa
• GenBank Accession Number: BC000518
• Gene Symbol: BASP1
• Gene ID (NCBI): 10409
• RRID: AB_3085444
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P80723
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.