PRRC2C Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PRRC2C Polyclonal antibody, PBS Only (31383-1-PBS)

• 

  WB analysis using 31383-1-AP (same clone as 31383-1-PBS)

  Various lysates were subjected to Tris-Acetate gel system followed by western blot with 31383-1-AP (BAT2D1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 31383-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 31383-1-AP (same clone as 31383-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using PRRC2C antibody (31383-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 31383-1-PBS in a different storage buffer formulation.

PRRC2C Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 31383-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

BAT2D1, BAT2 iso, BAT2L2, KIAA1096, XTP2

---

Product Information

31383-1-PBS targets PRRC2C in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag35409

  Product name: Recombinant human BAT2D1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 881-1050 aa of BC006090

  Sequence: DVRPHHTDANNQSACFEAPDQKTLSAPQEERISAVESQPSRKRSVSHGSNHTQKPDEQRSEPSAGIPKVTSRCIDSKEPIERPEEKPKKEGFIRSSEGPKPEKVYKSKSETRWGPRPSSNRREEVNDRPVRRSGPIKKPVLRDMKEEREQRKEKEGEKAEKVTEKVVVKP

• Full Name: BAT2 domain containing 1
• Observed Molecular Weight: 450 kDa
• GenBank Accession Number: BC006090
• Gene Symbol: BAT2D1
• Gene ID (NCBI): 23215
• RRID: AB_3742423
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q9Y520
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.