CoraLite® Plus 488-conjugated BAZ2A Recombinant monoclonal antibody

BAZ2A Uni-rAb® Recombinant Antibody for IF/ICC, FC (Intra)
Cat No. CL488-82910-2
Clone No.230205B8

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, FC (Intra)

WALp3, TTF I interacting protein 5, TIP5, KIAA0314, hWALp3

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inU2OS cells
Positive FC (Intra) detected inA549 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-82910-2 targets BAZ2A in IF/ICC, FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag33963

Product name: Recombinant human BAZ2A protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 97-295 aa of NM_013449.4

Sequence: QYPSANPGSNLKDPPLLSQFSGGQYPLNGILGGSRQPSSPSHNTNLRAGSQEFWANGTQSPMGLNFDSQELYDSFPDQNFEVMPNGPPSFFTSPQTSPMLGSSIQTFAPSQEVGSGIHPDEAAEKEMTSVVAENGTGLVGSLELEEEQPELKMCGYNGSVPSVESLHQEVSVLVPDPTVSCLDDPSHLPDQLEDTPILS

Predict reactive species
Full Name bromodomain adjacent to zinc finger domain, 2A
Calculated Molecular Weight211 kDa
Observed Molecular Weight250-270 kDa
GenBank Accession NumberNM_013449.4
Gene Symbol BAZ2A
Gene ID (NCBI) 11176
RRIDAB_3673111
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9UIF9
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

BAZ2A (bromodomain adjacent to zinc finger domain 2A), also known as TIP5. It is expected to be located in nucleus, and the protein is expressed at moderate levels in most tissues analyzed, including heart, brain, placenta, lung, skeletal muscle, kidney and pancreas. BAZ2A is an epigenetic regulator affecting transcription of ribosomal RNA, it is also a regulatory subunit of the ATP-dependent NoRC-1 and NoRC-5 ISWI chromatin remodeling complexes, which form ordered nucleosome arrays on chromatin and facilitate access to DNA during DNA-templated processes such as DNA replication, transcription, and repair (PubMed:28801535). The calculated molecular weight of BAZ2A is 210 kDa.

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 BAZ2A antibody CL488-82910-2Download protocol
IF protocol for CL Plus 488 BAZ2A antibody CL488-82910-2Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...