BBS2 Monoclonal antibody

• Home
• Products
• Primary Antibodies
• BBS2 Monoclonal antibody (66246-1-Ig)

BBS2 Monoclonal Antibody for WB, IF/ICC, ELISA

Cat No. 66246-1-Ig Copied!

Clone No. 2E11B3

Publications (2)

Download datasheet

Host / Isotype

Mouse / IgG3

Reactivity

human, Canine and More (1)

Applications

WB, IF/ICC, ELISA

Synonyms

Bardet Biedl syndrome 2, BBS, BBS2

• 

  WB analysis of K-562 using 66246-1-Ig

  K-562 cells were subjected to SDS PAGE followed by western blot with 66246-1-Ig (BBS2 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of MDCK using 66246-1-Ig

  Immunofluorescent images of MDCK cells stained with BBS2 mouse mAb (66246-1-Ig) and ARL13B rabbit pAb (17711-1-AP) at dilution of 1:50, further stained with Alexa Fluor 488-conjugated AffiniPure-Goat anti-Mouse IgG (H+L) for 66246-1-Ig, and Alexa Fluor 594-conjugated Goat Anti-Rabbit IgG (H+L) for 17711-1-AP.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for BBS2 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: K-562 cells
• Positive IF/ICC detected in: MDCK cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

66246-1-Ig targets BBS2 in WB, IF/ICC, ELISA applications and shows reactivity with human, Canine samples.

• Tested Reactivity: human, Canine
• Cited Reactivity: human, mouse
• Host / Isotype: Mouse / IgG3
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21390

  Product name: Recombinant human BBS2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-325 aa of BC014140

  Sequence: MLLPVFTLKLRHKISPRMVAIGRYDGTHPCLAAATQTGKVFIHNPHTRNQHVSASRVFQSPLESDVSLLNINQAVSCLTAGVLNPELGYDALLVGTQTNLLAYDVYNNSDLFYREVADGANVVVLGTLGDISSPLAIIGGNCALQGFNHEGSDLFWTVTGDNVNSLALCDFDGDGKKELLVGSEDFDIRVFKEDEIVAEMTETEIVTSLCPMYGSRFGYALSNGTVGVYDKTSRYWRIKSKNHAMSIHAFDLNSDGVNELITGWSNGKVDARSDRTGEVIFKDNFSSAIAGVVEGDYRMDGHIQLICCSVDGEIRGYLPGTAEMR

• Full Name: Bardet-Biedl syndrome 2
• Calculated Molecular Weight: 80 kDa
• Observed Molecular Weight: 80-90 kDa
• GenBank Accession Number: BC014140
• Gene Symbol: BBS2
• Gene ID (NCBI): 583
• RRID: AB_2881635
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9BXC9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The BBS2 Monoclonal antibody (2E11B3), catalog number 66246-1-Ig, has a total of 2 citations. These publications appear in Molecular & Cellular Proteomics (IF 6.3) and Journal of Biological Chemistry (IF 4.1). The cited research fields include CRISPR/Cas9-mediated genomic editing related to actin arrangement, and photoreceptor cell biology involving centrosomal protein localization. Both studies utilized the antibody for Western blot applications, with one in human samples and the other in mouse samples.

Automatically generated from the 2 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Mol Cell Proteomics; CRISPR/Cas9-mediated genomic editing of Cluap1/IFT38 reveals a new role in actin arrangement.; Authors - Tina Beyer
mouse	WB	J Biol Chem; The myosin-tail homology domain of centrosomal protein 290 is essential for protein confinement between the inner and outer segments in photoreceptors.; Authors - Poppy Datta