BBS2 Monoclonal antibody, PBS Only

• 

  WB analysis of K-562 using 66246-1-Ig (same clone as 66246-1-PBS)

  K-562 cells were subjected to SDS PAGE followed by western blot with 66246-1-Ig (BBS2 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66246-1-PBS in a different storage buffer formulation.

• 

  IF Staining of MDCK using 66246-1-Ig (same clone as 66246-1-PBS)

  Immunofluorescent images of MDCK cells stained with BBS2 mouse mAb (66246-1-Ig) and ARL13B rabbit pAb (17711-1-AP) at dilution of 1:50, further stained with Alexa Fluor 488-conjugated AffiniPure-Goat anti-Mouse IgG (H+L) for 66246-1-Ig, and Alexa Fluor 594-conjugated Goat Anti-Rabbit IgG (H+L) for 17711-1-AP. This data was developed using the same antibody clone with 66246-1-PBS in a different storage buffer formulation.

BBS2 Monoclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 66246-1-PBS

Clone No.2E11B3

Host / Isotype

Mouse / IgG3

Reactivity

human, Canine

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

Bardet Biedl syndrome 2, BBS, BBS2

---

Product Information

66246-1-PBS targets BBS2 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, Canine samples.

• Tested Reactivity: human, Canine
• Host / Isotype: Mouse / IgG3
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21390

  Product name: Recombinant human BBS2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-325 aa of BC014140

  Sequence: MLLPVFTLKLRHKISPRMVAIGRYDGTHPCLAAATQTGKVFIHNPHTRNQHVSASRVFQSPLESDVSLLNINQAVSCLTAGVLNPELGYDALLVGTQTNLLAYDVYNNSDLFYREVADGANVVVLGTLGDISSPLAIIGGNCALQGFNHEGSDLFWTVTGDNVNSLALCDFDGDGKKELLVGSEDFDIRVFKEDEIVAEMTETEIVTSLCPMYGSRFGYALSNGTVGVYDKTSRYWRIKSKNHAMSIHAFDLNSDGVNELITGWSNGKVDARSDRTGEVIFKDNFSSAIAGVVEGDYRMDGHIQLICCSVDGEIRGYLPGTAEMR

• Full Name: Bardet-Biedl syndrome 2
• Calculated Molecular Weight: 80 kDa
• Observed Molecular Weight: 80-90 kDa
• GenBank Accession Number: BC014140
• Gene Symbol: BBS2
• Gene ID (NCBI): 583
• RRID: AB_2881635
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9BXC9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.