Anti-Human BCAM Rabbit Recombinant Antibody

• Home
• Products
• Primary Antibodies
• Flow Cytometry Antibodies
• Anti-Human BCAM Rabbit Recombinant Antibody (98521-3-RR)

• 

  IF Staining of HT-29 using 98521-3-RR

  Immunofluorescent analysis of (-20°C Methanol) fixed HT-29 cells using BCAM antibody (98521-3-RR, Clone: 250778C11 ) at dilution of 1:500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

• 

  FC experiment of Human peripheral blood erythrocytes using 98521-3-RR

  1x10^6 human peripheral blood erythrocytes were surface stained with 0.25 ug Anti-Human BCAM Rabbit RecAb (98521-3-RR, Clone: 250778C11) or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were not fixed.

• 

  FC experiment of Human peripheral blood erythrocytes using 98521-3-RR

  1x10^6 human peripheral blood erythrocytes were surface stained with 0.25 ug Anti-Human BCAM Rabbit RecAb (98521-3-RR, Clone: 250778C11) (red) or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were not fixed.

BCAM Uni-rAb^® Recombinant Antibody for IF/ICC, FC

Cat No. 98521-3-RR

Clone No.250778C11

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, FC

Synonyms

Auberger B antigen, Basal cell adhesion molecule, B-CAM cell surface glycoprotein, CD239, F8/G253 antigen

---

Tested Applications

• Positive IF/ICC detected in: HT-29 cells
• Positive FC detected in: human peripheral blood erythrocytes

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000
• Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension

This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

98521-3-RR targets BCAM in IF/ICC, FC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2567

  Product name: Recombinant Human BCAM protein (rFc Tag) (HPLC verified)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 32-547 aa of BC050450

  Sequence: EVRLSVPPLVEVMRGKSVILDCTPTGTHDHYMLEWFLTDRSGARPRLASAEMQGSELQVTMHDTRGRSPPYQLDSQGRLVLAEAQVGDERDYVCVVRAGAAGTAEATARLNVFAKPEATEVSPNKGTLSVMEDSAQEIATCNSRNGNPAPKITWYRNGQRLEVPVEMNPEGYMTSRTVREASGLLSLTSTLYLRLRKDDRDASFHCAAHYSLPEGRHGRLDSPTFHLTLHYPTEHVQFWVGSPSTPAGWVREGDTVQLLCRGDGSPSPEYTLFRLQDEQEEVLNVNLEGNLTLEGVTRGQSGTYGCRVEDYDAADDVQLSKTLELRVAYLDPLELSEGKVLSLPLNSSAVVNCSVHGLPTPALRWTKDSTPLGDGPMLSLSSITFDSNGTYVCEASLPTVPVLSRTQNFTLLVQGSPELKTAEIEPKADGSWREGDEVTLICSARGHPDPKLSWSQLGGSPAEPIPGRQGWVSSSLTLKVTSALSRDGISCEASNPHGNKRHVFHFGTVSPQTSQA

• Full Name: basal cell adhesion molecule (Lutheran blood group)
• Calculated Molecular Weight: 67 kDa
• GenBank Accession Number: BC050450
• Gene Symbol: BCAM
• Gene ID (NCBI): 4059
• RRID: AB_3746149
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P50895
• Storage Buffer: PBS with 0.09% sodium azide, pH 7.3.
• Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.

Background Information

Basal cell adhesion molecule (Lu/BCAM) is a membrane-bound glycoprotein of the immunoglobulin superfamily (IgSF), functioning as a receptor for the extracellular matrix protein, laminin. BCAM (Lutheran/basal cell-adhesion molecule, a glycoprotein) belongs to the immunoglobulin superfamily which contains both Lu blood group and BCAM tumor-associated antigens. Proteomics analysis suggests that BCAM might be a potential biomarker for pancreatic cancer (PMID: 19199705). BCAM, involved in cell adhesion and migration, can also promote tumor metastasis and has been elucidated to play a functional role in the metastasis of thyroid cancer and gastric cancer (PMID: 10728810, 35941663).