BAP31 Recombinant monoclonal antibody, PBS Only

BAP31 Uni-rAb® Recombinant Antibody for WB, IHC, IF/ICC, FC (Intra), Indirect ELISA
Cat No. 84584-5-PBS
Clone No.241978D10

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), Indirect ELISA

BCAP31, BCR-associated protein 31, B-cell receptor-associated protein 31, 6C6-AG tumor-associated antigen, 6C6 AG

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84584-5-PBS targets BAP31 in WB, IHC, IF/ICC, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag1668

Product name: Recombinant human BCAP31 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-246 aa of BC014323

Sequence: MSLQWTAVATFLYAEVFVVLLLCIPFISPKRWQKIFKSRLVELLVSYGNTFFVVLIVILVLLVIDAVREIREYDDVTEKVNLQNNPGAMEHFHMKLFRAQRNLYIAGFSLLLSFLLRRLVTLISQQATLLASNEAFKKQAESASEAAKKYMEENDQLKKGAAVDGGKLDVGNAEVKLEEENRSLKADLQKLKDELASTKQKLEKAENQVLAMRKQSEGLTKEYDRLLEEHAKLQAAVDGPMDKKEE

Predict reactive species
Full Name B-cell receptor-associated protein 31
Calculated Molecular Weight 28 kDa
Observed Molecular Weight 28 kDa
GenBank Accession NumberBC014323
Gene Symbol BAP31
Gene ID (NCBI) 10134
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDP51572
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

BAP31, also known as BCAP31, is a chaperone protein abundant in the endoplasmic reticulum (ER). BAP31 plays a role in the export of secreted proteins in the ER, the recognition of abnormally folded proteins, and their targeting to the ER-associated-degradation (ERAD). CDIP1 and BAP31 interact upon ER stress to regulate the mitochondrial apoptosis pathway(PMID: 24139803). It also serves as a cargo receptor for the export of transmembrane proteins. BAP31 may be involved in apoptosis.

Loading...
||
New chat Able
正在加载,请稍候...