BCAS3 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• BCAS3 Polyclonal antibody, PBS Only (10402-1-PBS)

• 

  WB analysis using 10402-1-AP (same clone as 10402-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 10402-1-AP (BCAS3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10402-1-PBS in a different storage buffer formulation.

• 

  WB analysis of A431 using 10402-1-AP (same clone as 10402-1-PBS)

  WB result of BCAS3 antibody (10402-1-AP; 1:600; incubated at room temperature for 1.5 hours) with sh-Control and sh-BCAS3 transfected A431 cells. This data was developed using the same antibody clone with 10402-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

BCAS3 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 10402-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

10402-1-PBS targets BCAS3 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0646

  Product name: Recombinant human BCAS3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 653-928 aa of BC001250

  Sequence: SWTLVRTPQWNELQPPFNANHPLLLAADAVQYYQFLLAGLVPPGSPGPITRHGSYDSLASDHSGQEDEEWLSQVEIVTHTGPHRRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHGPSDTPQPLLDFDTDDLDLNSLRIQPVRSDPVSMPGSSRPVSDRRGVSTVIDAASGTFDRSVTLLEVCGSWPEGFGLRHMSSMEHTEEGLRERLADAMAESPSRDVVGSGTELQREGSIETLSNSSGSTSGSIPRNFDGYRSPLPTNESQPLSLFPTGFP

• Full Name: breast carcinoma amplified sequence 3
• Calculated Molecular Weight: 99 kDa
• Observed Molecular Weight: 74 kDa
• GenBank Accession Number: BC001250
• Gene Symbol: BCAS3
• Gene ID (NCBI): 54828
• RRID: AB_10897181
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H6U6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Rudhira/BCAS3 (Breast Cancer Amplified Sequence 3) is a conserved protein expressed in the embryonic vasculature and malignant tumors. Rudhira is a predicted WD40 domain protein. During mouse development Rudhira is expressed in erythropoietic and angiogenic precursors but not in their differentiated progeny. This transient expression of Rudhira is also seen in normal adult angiogenesis. BCAS3, the human ortholog of Rudhira is 98% identical and the gene maps to a breakpoint of hematological neoplasms on chromosome 17q23.1. BCAS3 is also expressed in vascular development in embryoid bodies in vitro and was originally identified as a gene over-expressed in breast cancers. It is reported to be a target of metastasis associated protein-1 (MTA-1). Further BCAS3 expression is also upregulated in grade III and IV glioblastomas where it is misexpressed in the tumor cells.