Use Able AI chat for product recommendations

CoraLite® Plus 647-conjugated BCDIN3D Recombinant monoclonal antibody

BCDIN3D Uni-rAb® Recombinant Antibody for

Cat No. CL647-83309
Clone No.240152A9

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

240152A9, BCDIN3 domain-containing protein, EC:2.1.1.-, RNA 5'-monophosphate methyltransferase

Formulation:  PBS, Proclin300, BSA, Glycerol
PBS, Proclin300, BSA, Glycerol
Conjugate:  CoraLite® Plus 647
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

CL647-83309 targets BCDIN3D in applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag15613

Product name: Recombinant human BCDIN3D protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-292 aa of BC053560

Sequence: MAVPTELDGGSVKETAAEEESRVLAPGAAPFGNFPHYSRFHPPEQRLRLLPPELLRQLFPESPENGPILGLDVGCNSGDLSVALYKHFLSLPDGETCSDASREFRLLCCDIDPVLVKRAEKECPFPDALTFITLDFMNQRTRKVLLSSFLSQFGRSVFDIGFCMSITMWIHLNHGDHGLWEFLAHLSSLCHYLLVEPQPWKCYRAAARRLRKLGLHDFDHFHSLAIRGDMPNQIVQILTQDHGMELICCFGNTSWDRSLLLFRAKQTIETHPIPESLIEKGKEKNRLSFQKQ

Predict reactive species
Full Name BCDIN3 domain containing
Calculated Molecular Weight 292 aa, 33 kDa
Observed Molecular Weight33 kDa
GenBank Accession NumberBC053560
Gene Symbol BCDIN3D
Gene ID (NCBI) 144233
Conjugate CoraLite® Plus 647 Fluorescent Dye
Excitation/Emission Maxima Wavelengths654 nm / 674 nm
Excitation LaserRed Laser (633 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ7Z5W3
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

BCDIN3D (BCDIN3 domain containing RNA methyltransferase), it is expected to be located in cytoplasm, which is ubiquitous expressed in prostate, lymph node and skeletal muscle. This gene encodes an RNA methyltransferase which belongs to the rossmann fold methyltransferase family and serves as a 5'-methylphosphate capping enzyme that is specific for cytoplasmic histidyl tRNA. The encoded protein contains an S-adenosylmethionine binding domain and uses the methyl group donor, S-adenosylmethionine. This gene is overexpressed in breast cancer cells, and is related to the tumorigenic phenotype and poor prognosis of breast cancer. The encoded protein is thought to promote the cellular invasion of breast cancer cells, by downregulating the expression of tumor suppressor miRNAs through the dimethylation of the 5-monophosphate of the corresponding precursor miRNAs. The molecular weight of BCDIN3D is 33 kDa.

Loading...
||
New chat

Able

正在加载,请稍候...