BCL11A Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• BCL11A Polyclonal antibody, PBS Only (11613-1-PBS)

• 

  WB analysis using 11613-1-AP (same clone as 11613-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 11613-1-AP (BCL11A antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11613-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsillitis using 11613-1-AP (same clone as 11613-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 11613-1-AP (BCL11A antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11613-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsillitis using 11613-1-AP (same clone as 11613-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 11613-1-AP (BCL11A antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11613-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human gliomas using 11613-1-AP (same clone as 11613-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 11613-1-AP (BCL11A antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11613-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human gliomas using 11613-1-AP (same clone as 11613-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 11613-1-AP (BCL11A antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11613-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse spleen using 11613-1-AP (same clone as 11613-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 11613-1-AP (BCL11A antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11613-1-PBS in a different storage buffer formulation.

BCL11A Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 11613-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

B cell lymphoma/leukaemia 11A, B-cell CLL/lymphoma 11A, B-cell lymphoma/leukemia 11A, BCL-11A, COUP-TF-interacting protein 1

---

Product Information

11613-1-PBS targets BCL11A in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2187

  Product name: Recombinant human BCL11A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-351 aa of BC021098

  Sequence: MSRRKQGKPQHLSKREFSPEPLEAILTDDEPDHGPLGAPEGDHDLLTCGQCQMNFPLGDILIFIEHKRKQCNGSLCLEKAVDKPPSPSPIEMKKASNPVEVGIQVTPEDDDCLSTSSRGICPKQEHIADKLLHWRGLSSPRSAHGALIPTPGMSAEYAPQGICKDEPSSYTCTTCKQPFTSAWFLLQHAQNTHGLRIYLESEHGSPLTPRVGIPSGLGAECPSQPPLHGIHIADNNPFNLLRIPGSVSREASGLAEGRFPPTPPLFSPPPRHHLDPHRIERLGAEEMALATHHPSAFDRVLRLNPMAMEPPAMDFSRRLRELAGNTSSPPLSPGRPSPMQRLLQPFQPGSK

• Full Name: B-cell CLL/lymphoma 11A (zinc finger protein)
• Calculated Molecular Weight: 835 aa, 91 kDa
• GenBank Accession Number: BC021098
• Gene Symbol: BCL11A
• Gene ID (NCBI): 53335
• RRID: AB_2259028
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H165
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

B-CELL CLL/LYMPHOMA 11A(BCL11A)is a highly conserved zinc finger gene. It acts as a myeloid and B-cell proto-oncogene, and may play key roles in leukemogenesis and hematopoiesis. It is an essential factor in lymphopoiesis, and required for B-cell formation in fetal liver. May function as a modulator of the transcriptional repression activity of ARP1. It is also involved in lymphoid malignancies through translocation or amplification events. It has recently been shown that BCL11A expression is inversely correlated with γ globin expression.(PMID:21156846). This is a rabbit polyclonal antibody raised against part chain of N-terminal BCL11A of human origin. There are three isoforms of BCL11A: isoform1(773aa), isoform2(486aa) and isoform3(239aa)