BCL2 Recombinant monoclonal antibody

• 

  WB analysis using 80313-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 80313-1-RR (BCL2 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HL-60 using 80313-1-RR

  IP result of anti-BCL2 (IP:80313-1-RR, 4ug; Detection:80313-1-RR 1:8000) with HL-60 cells lysate 1200 ug.

• 

  IHC staining of human breast cancer using 80313-1-RR

  Immunohistochemical analysis of paraffin-embedded Human Breast Cancer tissue slide using 80313-1-RR (BCL2 antibody) at dilution of 1:300 (under 40x lens). Heat mediated antigen retrieval with Tris EDTA (pH 9.0) buffer. Staining was performed on the Biocare NeoPATH Pro.

• 

  IHC staining of Human Tonsil​ using 80313-1-RR

  Immunohistochemical analysis of paraffin-embedded Human Tonsil tissue slide using 80313-1-RR (BCL2 antibody) at dilution of 1:300 (under 40x lens). Heat mediated antigen retrieval with Tris EDTA (pH 9.0) buffer. Staining was performed on the Biocare NeoPATH Pro.

• 

  IHC staining of human tonsillitis using 80313-1-RR

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 80313-1-RR (BCL2 antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human tonsillitis using 80313-1-RR

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 80313-1-RR (BCL2 antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of human tonsillitis using 80313-1-RR

  Immunofluorescent analysis of (4% PFA) fixed human tonsillitis tissue using BCL2 antibody (80313-1-RR, Clone: 3O5 ) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• 

  IF Staining of human appendicitis using 80313-1-RR

  Immunofluorescent analysis of (4% PFA) fixed human appendicitis tissue using BCL2 antibody (80313-1-RR, Clone: 3O5 ) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• 

  Affinity and Kinetic Characterization of 80313-1-RR

  Biolayer interferometry (BLl) kinetic assays of 80313-1-RR against Human BCL2 were performed. The affinity constant is 5.06 nM.

BCL2 Uni-rAb^® Recombinant Antibody for WB, IHC, IHC-Autostainer, IF-P, IP, ELISA

Cat No. 80313-1-RR

Clone No.3O5

Publications(10)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IHC-Autostainer, IF-P, IP, ELISA

Synonyms

BCL-2

---

Tested Applications

• Positive WB detected in: Jurkat cells, Raji cells, THP-1 cells, HL-60 cells, U-937 cells
• Positive IP detected in: HL-60 cells
• Positive IHC-Autostainer detected in: human breast cancer tissue, Human Tonsil​
• Positive IHC detected in: human tonsillitis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: human tonsillitis tissue, human appendicitis tissue

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC)-AUTOSTAINER: IHC-AUTOSTAINER : 1:150-1:600
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 9 publications below
• IHC: See 2 publications below

Product Information

80313-1-RR targets BCL2 in WB, IHC, IHC-Autostainer, IF-P, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag3508

  Product name: Recombinant human BCL2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-239 aa of BC027258

  Sequence: MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK

• Full Name: B-cell CLL/lymphoma 2
• Calculated Molecular Weight: 26 kDa
• Observed Molecular Weight: 26 kDa
• GenBank Accession Number: BC027258
• Gene Symbol: BCL2
• Gene ID (NCBI): 596
• RRID: AB_2918886
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P10415
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

BCL2 belongs to the Bcl-2 family. It suppresses apoptosis in a variety of cell systems including factor-dependent lymphohematopoietic and neural cells. BCL2 regulates cell death by controlling the mitochondrial membrane permeability (PMID: 10365962). It appears to function in a feedback loop system with caspases. BCL2 inhibits caspase activity either by preventing the release of cytochrome c from the mitochondria and/or by binding to the apoptosis-activating factor (APAF-1) (PMID: 10444588).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IHC	J Pharm Anal; Rapid discovery of a novel "green" and natural GST inhibitor for sensitizing hepatocellular carcinoma to Cisplatin by visual screening strategy.; Authors - Linxi Mao
human	WB	Cell Biol Toxicol; The key regulator circPDE3B promotes arsenic-induced bladder carcinogenesis by affecting STAT3 and NF-κB stability; Authors - Yihong Gao
		Acta Biomater; Bioactive Glass-Induced B Cell Depletion Remodels the Osteoimmunological Microenvironment to Enhance Osteogenesis; Authors - Yue Chen
	WB	Clin Transl Med; Targeting c-Myc enhances immunotherapy efficacy in combination with Ras inhibitor in triple-negative breast cancer; Authors - Xiaojie Liang
human	WB,IHC	Cell Death Dis; TRIM25 degrades BRD7 protein stability through the ubiquitin proteasome pathway to promote breast cancer progression and paclitaxel resistance by activating YB1/Bcl-2 transcription axis.; Authors - Changning Xue
mouse,human	WB	Chin Med; Protective effects of Notoginsenoside R2 on reducing lipid accumulation and mitochondrial dysfunction in diabetic nephropathy through regulation of c-Src; Authors - Xieyi Guo