Tested Applications
| Positive WB detected in | Jurkat cells, Raji cells, THP-1 cells, HL-60 cells, U-937 cells |
| Positive IP detected in | HL-60 cells |
| Positive IHC-Autostainer detected in | human breast cancer tissue, Human Tonsil |
| Positive IHC detected in | human tonsillitis tissue, human appendicitis tissue, human lymphoma tissue, human spleen tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | human tonsillitis tissue, human appendicitis tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC)-AUTOSTAINER | IHC-AUTOSTAINER : 1:150-1:600 |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
80313-1-RR targets BCL2 in WB, IHC, IHC-Autostainer, IF-P, IP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag3508 Product name: Recombinant human BCL2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-239 aa of BC027258 Sequence: MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK Predict reactive species |
| Full Name | B-cell CLL/lymphoma 2 |
| Calculated Molecular Weight | 26 kDa |
| Observed Molecular Weight | 26 kDa |
| GenBank Accession Number | BC027258 |
| Gene Symbol | BCL2 |
| Gene ID (NCBI) | 596 |
| RRID | AB_2918886 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P10415 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
BCL2 belongs to the Bcl-2 family. It suppresses apoptosis in a variety of cell systems including factor-dependent lymphohematopoietic and neural cells. BCL2 regulates cell death by controlling the mitochondrial membrane permeability (PMID: 10365962). It appears to function in a feedback loop system with caspases. BCL2 inhibits caspase activity either by preventing the release of cytochrome c from the mitochondria and/or by binding to the apoptosis-activating factor (APAF-1) (PMID: 10444588).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for BCL2 antibody 80313-1-RR | Download protocol |
| IHC protocol for BCL2 antibody 80313-1-RR | Download protocol |
| IP protocol for BCL2 antibody 80313-1-RR | Download protocol |
| WB protocol for BCL2 antibody 80313-1-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The BCL2 Recombinant monoclonal antibody (3O5), catalog number 80313-1-RR, has 22 citations. These appear in journals including Cell Death & Disease, Journal of Pharmaceutical Analysis, Acta Biomaterialia, Journal of Medicinal Chemistry, Journal of Investigative Dermatology, ACS Applied Bio Materials, Brain Research Bulletin, and PLoS One, among others. Research fields span breast cancer, hepatocellular carcinoma, diabetic nephropathy, ferroptosis, neuroinflammation, ischemic stroke, intracerebral hemorrhage, atherosclerosis, osteogenesis, and colon cancer.
| Species | Application | Title |
|---|---|---|
Cell Death Dis TRIM25 degrades BRD7 protein stability through the ubiquitin proteasome pathway to promote breast cancer progression and paclitaxel resistance by activating YB1/Bcl-2 transcription axis. | ||
J Pharm Anal Rapid discovery of a novel "green" and natural GST inhibitor for sensitizing hepatocellular carcinoma to Cisplatin by visual screening strategy. | ||
Mater Today Bio Mitochondria-targeted phototherapeutic system enabling spatiotemporal-controlled NADH depletion for keloid intervention. | ||
Acta Biomater Bioactive Glass-Induced B Cell Depletion Remodels the Osteoimmunological Microenvironment to Enhance Osteogenesis | ||
Clin Transl Med Targeting c-Myc enhances immunotherapy efficacy in combination with Ras inhibitor in triple-negative breast cancer | ||
Chin Med Protective effects of Notoginsenoside R2 on reducing lipid accumulation and mitochondrial dysfunction in diabetic nephropathy through regulation of c-Src |
