Use Able AI chat for product recommendations

BCL2 Recombinant monoclonal antibody

BCL2 Uni-rAb® Recombinant Antibody for WB, IHC, IHC-Autostainer, IF-P, IP, ELISA

Cat No. 80313-1-RR
Clone No.3O5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IHC-Autostainer, IF-P, IP, ELISA

BCL-2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inJurkat cells, Raji cells, THP-1 cells, HL-60 cells, U-937 cells
Positive IP detected inHL-60 cells
Positive IHC-Autostainer detected inhuman breast cancer tissue, Human Tonsil​
Positive IHC detected inhuman tonsillitis tissue, human appendicitis tissue, human lymphoma tissue, human spleen tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inhuman tonsillitis tissue, human appendicitis tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)-AUTOSTAINERIHC-AUTOSTAINER : 1:150-1:600
Immunohistochemistry (IHC)IHC : 1:200-1:800
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

80313-1-RR targets BCL2 in WB, IHC, IHC-Autostainer, IF-P, IP, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag3508

Product name: Recombinant human BCL2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-239 aa of BC027258

Sequence: MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK

Predict reactive species
Full Name B-cell CLL/lymphoma 2
Calculated Molecular Weight 26 kDa
Observed Molecular Weight26 kDa
GenBank Accession NumberBC027258
Gene Symbol BCL2
Gene ID (NCBI) 596
RRIDAB_2918886
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP10415
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

BCL2 belongs to the Bcl-2 family. It suppresses apoptosis in a variety of cell systems including factor-dependent lymphohematopoietic and neural cells. BCL2 regulates cell death by controlling the mitochondrial membrane permeability (PMID: 10365962). It appears to function in a feedback loop system with caspases. BCL2 inhibits caspase activity either by preventing the release of cytochrome c from the mitochondria and/or by binding to the apoptosis-activating factor (APAF-1) (PMID: 10444588).

Protocols

Product Specific Protocols
IF protocol for BCL2 antibody 80313-1-RRDownload protocol
IHC protocol for BCL2 antibody 80313-1-RRDownload protocol
IP protocol for BCL2 antibody 80313-1-RRDownload protocol
WB protocol for BCL2 antibody 80313-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB,IHC

ACS Appl Bio Mater

PDA-Based Nanoplatform with High Ligustilide Loading for Simultaneous Elimination of Breast Cancer Cells and Stem Cells Via BAX/BCL-2/Caspase-3 Pathway Activation.

Authors - Wenjing Zhang
humanWB

Bioorg Chem

A new specific GluN2B partial antagonist ameliorates brain injury caused by ischemic stroke in rats

Authors - Yanhua Fan
humanWB

Chin Med

Protective effects of Notoginsenoside R2 on reducing lipid accumulation and mitochondrial dysfunction in diabetic nephropathy through regulation of c-Src

Authors - Xieyi Guo
humanWB

PLoS One

Enhancement of YTHDF2 plays a protective role in acute IRI models through downregulation of TUG1 expression

Authors - Hong-Fei He
humanWB

Hereditas

TRV130 inhibits colon cancer progression via suppressing the Hedgehog signaling pathway: in vitro and in vivo evidence.

Authors - Yuanzhao Zhuang
humanWB,IHC

Cell Death Dis

TRIM25 degrades BRD7 protein stability through the ubiquitin proteasome pathway to promote breast cancer progression and paclitaxel resistance by activating YB1/Bcl-2 transcription axis.

Authors - Changning Xue
Loading...
||
New chat

Able

正在加载,请稍候...