CoraLite® Plus 647-conjugated BCL2 Recombinant monoclonal antibody

• 

  IF Staining of human appendicitis using CL647-80313

  Immunofluorescent analysis of (4% PFA) fixed human appendicitis tissue using CoraLite® Plus 647 BCL2 antibody (CL647-80313, Clone: 3O5 ) at dilution of 1:200.

• 

  IF Staining of human appendicitis using CL647-80313

  Immunofluorescent analysis of (4% PFA) fixed human appendicitis tissue using CoraLite® Plus 647 BCL2 antibody (CL647-80313, Clone: 3O5 ) at dilution of 1:200.

• 

  FC experiment of Jurkat using CL647-80313

  1X10^6 Jurkat cells were intracellularly stained with 0.4 ug CoraLite® Plus 647 Anti-Human BCL2 (CL647-80313, Clone:3O5) (red), or 0.4 ug Control Antibody. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

BCL2 Uni-rAb^® Recombinant Antibody for IF-P, FC (Intra)

Cat No. CL647-80313

Clone No.3O5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF-P, FC (Intra)

Synonyms

BCL-2, 3O5

---

Tested Applications

• Positive IF-P detected in: human appendicitis tissue
• Positive FC (Intra) detected in: Jurkat cells

Recommended dilution

• Immunofluorescence (IF)-P: IF-P : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL647-80313 targets BCL2 in IF-P, FC (Intra) applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag3508

  Product name: Recombinant human BCL2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-239 aa of BC027258

  Sequence: MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK

• Full Name: B-cell CLL/lymphoma 2
• Calculated Molecular Weight: 26 kDa
• Observed Molecular Weight: 26 kDa
• GenBank Accession Number: BC027258
• Gene Symbol: BCL2
• Gene ID (NCBI): 596
• RRID: AB_2935089
• Conjugate: CoraLite® Plus 647 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 654 nm / 674 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P10415
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

BCL2 belongs to the Bcl-2 family. It suppresses apoptosis in a variety of cell systems including factor-dependent lymphohematopoietic and neural cells. BCL2 regulates cell death by controlling the mitochondrial membrane permeability (PMID: 10365962). It appears to function in a feedback loop system with caspases. BCL2 inhibits caspase activity either by preventing the release of cytochrome c from the mitochondria and/or by binding to the apoptosis-activating factor (APAF-1) (PMID: 10444588).