• Featured Product
  • KD/KO Validated

CoraLite® Plus 647-conjugated BCL2 Polyclonal antibody

BCL2 Polyclonal Antibody for
Cat No. CL647-12789

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Apoptosis regulator Bcl 2, B cell CLL/lymphoma 2, BCL2, BCL-2, Oncogene B cell leukemia 2

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 647
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

CL647-12789 targets BCL2 in applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag3508

Product name: Recombinant human BCL2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-239 aa of BC027258

Sequence: MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK

Predict reactive species
Full Name B-cell CLL/lymphoma 2
Calculated Molecular Weight 26 kDa
Observed Molecular Weight 25-30 kDa
GenBank Accession NumberBC027258
Gene Symbol BCL2
Gene ID (NCBI) 596
Conjugate CoraLite® Plus 647 Fluorescent Dye
Excitation/Emission Maxima Wavelengths654 nm / 674 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP10415
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

1. What is Bcl-2?

Bcl-2 (B-cell lymphoma 2) is an outer mitochondrial membrane protein that via heterodimerization with BAX proteins controls apoptosis. Abnormalities of Bcl-2 activity can lead to cancer, autoimmune diseases, and schizophrenia.

2. FAQs for Bcl-2

 a. How to measure Bcl-2 and Bax apoptotic markers by western blotting

Generally, Bcl-2 protein is considered to have anti-apoptotic activity, while Bax has apoptotic activity. Comparing the ratio between Bcl-2 and Bax protein levels in different samples or cells subjected to treatments can reflect the apoptotic state of the cells. Expression of Bax can vary between cell lines and it is important to compare it to Bcl-2 levels.

b. What band size should I expect in western blotting for Bcl-2?

The molecular weight of Bcl-2 is 26 kDa.


Loading...
||
New chat Able
正在加载,请稍候...