BCL6 Monoclonal antibody, PBS Only

• 

  WB analysis of Ramos using 66340-1-Ig (same clone as 66340-1-PBS)

  Ramos cells were subjected to SDS PAGE followed by western blot with 66340-1-Ig (BCL6 Antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66340-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Daudi using 66340-1-Ig (same clone as 66340-1-PBS)

  Daudi cells were subjected to SDS PAGE followed by western blot with 66340-1-Ig (BCL6 antibody) at dilution of 1:15000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66340-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Raji using 66340-1-Ig (same clone as 66340-1-PBS)

  Raji cells were subjected to SDS PAGE followed by western blot with 66340-1-Ig (BCL6 Antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66340-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsillitis using 66340-1-Ig (same clone as 66340-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 66340-1-Ig (BCL6 antibody) at dilution of 1:4000 (under 4x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66340-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsillitis using 66340-1-Ig (same clone as 66340-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 66340-1-Ig (BCL6 antibody) at dilution of 1:4000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66340-1-PBS in a different storage buffer formulation.

BCL6 Monoclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 66340-1-PBS

Clone No.1E6B1

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

BCL-6, 1E6B1, B cell CLL/lymphoma 6, B cell lymphoma 6 protein, B-cell lymphoma 5 protein

---

Product Information

66340-1-PBS targets BCL6 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15519

  Product name: Recombinant human BCL6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 183-532 aa of BC150184

  Sequence: SLYSGLSTPPASYSMYSHLPVSSLLFSDEEFRDVRMPVANPFPKERALPCDSARPVPGEYSRPTLEVSPNVCHSNIYSPKETIPEEARSDMHYSVAEGLKPAAPSARNAPYFPCDKASKEEERPSSEDEIALHFEPPNAPLNRKGLVSPQSPQKSDCQPNSPTESCSSKNACILQASGSPPAKSPTDPKACNWKKYKFIVLNSLNQNAKPEGPEQAELGRLSPRAYTAPPACQPPMEPENLDLQSPTKLSASGEDSTIPQASRLNNIVNRSMTGSPRSSSESHSPLYMHPPKCTSCGSQSPQHAEMCLHTAGPTFPEEMGETQSEYSDSSCENGAFFCNECDCRFSEEAS

• Full Name: B-cell CLL/lymphoma 6
• Calculated Molecular Weight: 706 aa, 79 kDa
• Observed Molecular Weight: 85 kDa
• GenBank Accession Number: BC150184
• Gene Symbol: BCL6
• Gene ID (NCBI): 604
• RRID: AB_2881720
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P41182
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

BCL6, a zinc finger transcription factor, contains an N-terminal BTB/POZ domain and C-terminal zinc finger DNA-binding motifs and represses transcription of a wide range of target proteins and microRNAs. BCL6 protein has been reported as a master regulator of B lymphocyte development and growth, and altered BCL6 protein expression was implicated in pathogenesis of diverse human hematologic malignancies, especially in the diffuse large B cell lymphoma (DLBCL). BCL6 is required for the development of T follicular helper T cells (TFH), a helper T cell subset required for the formation of mature and productive GCs. BCL6 has also been shown to play important regulatory roles in macrophages.