BCL9L Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• BCL9L Polyclonal antibody, PBS Only (32103-1-PBS)

• 

  WB analysis using 32103-1-AP (same clone as 32103-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 32103-1-AP (BCL9L antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 32103-1-PBS in a different storage buffer formulation.

• 

  IF Staining of MCF-7 using 32103-1-AP (same clone as 32103-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using BCL9L antibody (32103-1-AP) at dilution of 1:800 and CoraLite®594-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-4). This data was developed using the same antibody clone with 32103-1-PBS in a different storage buffer formulation.

BCL9L Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 32103-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

Nuclear Co-Factor Of Beta-Catenin Signalling, DLNB11, BCL9-like protein, B-cell lymphoma 9-like protein, B-cell CLL/lymphoma 9-like protein

---

Product Information

32103-1-PBS targets BCL9L in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag36794

  Product name: Recombinant human BCL9L protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 38-206 aa of NM_182557

  Sequence: MHPENKLTNHGKTGNGGAQSQHQNVNQGPTCNVGSKGVGAGNHGAKANQISPSNSSLKNPQAGVPPFSSLKGKVKRDRSVSVDSGEQREAGTPSLDSEAKEVAPRSKRRCVLERKQPYSGDEWCSGPDSEEDDKPIGATHNCNVADPAMAAPQLGPGQTTQLPLSESSV

• Full Name: B-cell CLL/lymphoma 9-like
• Calculated Molecular Weight: 157 kDa
• Observed Molecular Weight: 220 kDa
• GenBank Accession Number: NM_182557
• Gene Symbol: BCL9L
• Gene ID (NCBI): 283149
• RRID: AB_3670192
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q86UU0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

B-cell CLL/lymphoma 9-like protein (BCL9L, also known as B9L, BCL9-2, and DLNB11) is a transcriptional regulator that acts as an activator, which locates in nucleolus and nucleoplasm (PMID: 33767438). It is predicted to be implicated in the WNT-β-catenin signaling pathway to regulate the progress of hepatocellular carcinoma, breast cancer, and colon cancer (PMID: 31440992; 34545187; 30698996).