Use Able AI chat for product recommendations

CoraLite® Plus 750 Anti-Human BCMA/TNFRSF17 Rabbit Recombinant Antibody

BCMA/TNFRSF17 Uni-rAb® Recombinant Antibody for FC

Cat No. CL750-98215
Clone No.241731A11

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC

TNFRSF17, 241731A11, B-cell maturation protein, BCM, BCMA

Formulation:  PBS, Azide, BSA
PBS, Azide, BSA
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC detected inU266 cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC)FC : 5 ul per 10^6 cells in 100 μl suspension
This reagent has been pre-titrated and tested for flow cytometric analysis. The suggested use of this reagent is 5 ul per 10^6 cells in a 100 µl suspension or 5 ul per 100 µl of whole blood.
Sample-dependent, Check data in validation data gallery.

Product Information

CL750-98215 targets BCMA/TNFRSF17 in FC applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg1812

Product name: Recombinant Human BCMA/TNFRSF17 protein (rFc Tag)

Source: mammalian cells-derived, pHZ-KIsec-C-rFc

Tag: C-rFc

Domain: 1-54 aa of BC058291

Sequence: MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA

Predict reactive species
Full Name tumor necrosis factor receptor superfamily, member 17
Calculated Molecular Weight 184 aa, 20 kDa
GenBank Accession NumberBC058291
Gene Symbol TNFRSF17
Gene ID (NCBI) 608
RRIDAB_3749097
Conjugate CoraLite® Plus 750 Fluorescent Dye
Excitation/Emission Maxima Wavelengths755 nm / 780 nm
Excitation LaserRed Laser (633 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ02223
Storage Buffer PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.
Storage ConditionsStore at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

BCMA (B cell maturation antigen), also known as TNFRSF17, is 20.2-kDa type III transmembrane glycoprotein and is a member of the TNF-receptor superfamily. This receptor is preferentially expressed in mature B lymphocytes and plasma cells, which may be important for B cell development and autoimmune response (PMID: 32943087; 9846698). BCMA has two agonist ligands: a proliferation-inducing ligand (APRIL) and BAFF. When BCMA binds to APRIL, it transmits signals of cell survival and proliferation (PMID: 27127303); when BCMA binds to BAFF, it mediates the activation of NF-kappaB and MAPK8/JNK (PMID: 36140254). It has been found that the overexpression and activation of BCMA are associated with multiple myeloma (MM) in preclinical models and humans, supporting its potential utility as a therapeutic target for MM (PMID: 32055000; 32943087).

Protocols

Product Specific Protocols
FC protocol for CL Plus 750 BCMA/TNFRSF17 antibody CL750-98215Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...