BCMO1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• BCMO1 Polyclonal antibody, PBS Only (23308-1-PBS)

• 

  WB analysis of COLO 320 using 23308-1-AP (same clone as 23308-1-PBS)

  COLO 320 cells were subjected to SDS PAGE followed by western blot with 23308-1-AP (BCMO1 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 23308-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse colon using 23308-1-AP (same clone as 23308-1-PBS)

  mouse colon tissue were subjected to SDS PAGE followed by western blot with 23308-1-AP (BCMO1 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 23308-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 23308-1-AP (same clone as 23308-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 23308-1-AP (BCMO1 Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 23308-1-PBS in a different storage buffer formulation.

BCMO1 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 23308-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

23308-1-PBS targets BCMO1 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19732

  Product name: Recombinant human BCMO1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 199-547 aa of BC126210

  Sequence: FKIPATVPEGKKQGKSPWKHTEVFCSIPSRSLLSPSYYHSFGVTENYVIFLEQPFRLDILKMATAYIRSMSWASCLAFHREEKTYIHIIDQRTRQPVQTKFYTDAMVVFHHVNAYEEDGCIVFDVIAYEDNSLYQLFYLANLNQDFKENSRLTSVPTLRRFAVPLHVDKNAEVGTNLIKVASTTATALKEEDGQVYCQPEFLYEGLELPRVNYAHNGKQYRYVFATGVQWSPIPTKIIKYDILTKSSLKWREDDCWPAEPLFVPAPGAKDEDDGVILSAIVSTDPQKLPFLLILDAKSFTELARASVDVDMHMDLHGLFITDMDWDTKKQAASEEQRDRASDCHGAPLT

• Full Name: beta-carotene 15,15'-monooxygenase 1
• Calculated Molecular Weight: 547 aa, 63 kDa
• Observed Molecular Weight: 65 kDa
• GenBank Accession Number: BC126210
• Gene Symbol: BCMO1
• Gene ID (NCBI): 53630
• RRID: AB_2879252
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9HAY6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

BCMO1(Beta,beta-carotene 15,15'-monooxygenase) is also named as BCDO, BCDO1 and belongs to the carotenoid oxygenase family.The human BCMO1 cDNA encodes a 63-kDa protein with homologies to members of a large and diverse family of polyene chain oxidases and carotenoid cleavage enzymes.Although BCMO1 can be detected in several tissues, its expression is most pronounced in intestinal mucosa and liver(PMID:16504037).It catalyzes the central cleavage of β-carotene to all-trans retinal and is the key enzyme in the intestinal metabolism of carotenes to vitamin A.