BCO2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• BCO2 Polyclonal antibody, PBS Only (14324-1-PBS)

• 

  WB analysis using 14324-1-AP (same clone as 14324-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 14324-1-AP (BCO2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14324-1-PBS in a different storage buffer formulation.

• 

  WB analysis of L02 using 14324-1-AP (same clone as 14324-1-PBS)

  L02 cells were subjected to SDS PAGE followed by western blot with 14324-1-AP (BCO2 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14324-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse liver using 14324-1-AP (same clone as 14324-1-PBS)

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 14324-1-AP (BCO2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14324-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate hyperplasia using 14324-1-AP (same clone as 14324-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate hyperplasia tissue slide using 14324-1-AP (BCO2 antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 14324-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate hyperplasia using 14324-1-AP (same clone as 14324-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate hyperplasia tissue slide using 14324-1-AP (BCO2 antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 14324-1-PBS in a different storage buffer formulation.

BCO2 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 14324-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

14324-1-PBS targets BCO2 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5590

  Product name: Recombinant human BCO2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 159-506 aa of BC041656

  Sequence: ERFMSRFELPGKAAGFSYKVIRVPPEKVDLGETIHGVQVICSIASTEKGKPSYYHSFGMTRNYIIFIEQPLKMNLWKIATSKIRGKAFSDGISWEPQCNTRFHVVEKRTGQLLPGRYYSKPFVTFHQINAFEDQGCVIIDLCCQDNGRTLEVYQLQNLRKAGEGLDQVHNSAAKSFPRRFVLPLNVSLNAPEGDNLSPLSYTSASAVKQADGTIWCSHENLHQEDLEKEGGIEFPQIYYDRFSGKKYHFFYGCGFRHLVGDSLIKVDVVNKTLKVWREDGFYPSEPVFVPAPGTNEEDGGVILSVVITPNQNESNFLLVLDAKNFEELGRAEVPVQMPYGFHGTFIPI

• Full Name: beta-carotene oxygenase 2
• Calculated Molecular Weight: 66 kDa
• Observed Molecular Weight: 60-65 kDa
• GenBank Accession Number: BC041656
• Gene Symbol: BCO2
• Gene ID (NCBI): 83875
• RRID: AB_2227901
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BYV7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Beta,beta-carotene 9',10'-oxygenase (BCO2) catalyzes the asymmetric oxidative cleavage of beta-carotene in carotene metabolism.The apocarotenals formed by this enzyme may be the precursors for the biosynthesis of retinoic acid or exert unknown physiological effects. BCDO2 plays an important role in protecting against carotenoid-induced mitochondrial dysfunction and has a broader substrate specificity than previously recognized (PMID:22147584). This antibody detects the N-terminal of BCO2.