BEGAIN Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• BEGAIN Polyclonal antibody, PBS Only (14956-1-PBS)

• 

  WB analysis using 14956-1-AP (same clone as 14956-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 14956-1-AP (BEGAIN antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14956-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas cancer using 14956-1-AP (same clone as 14956-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 14956-1-AP (BEGAIN antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 14956-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas cancer using 14956-1-AP (same clone as 14956-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 14956-1-AP (BEGAIN antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 14956-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 14956-1-AP (same clone as 14956-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 14956-1-AP (BEGAIN antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 14956-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 14956-1-AP (same clone as 14956-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 14956-1-AP (BEGAIN antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 14956-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 14956-1-AP (same clone as 14956-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 14956-1-AP (BEGAIN antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 14956-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 14956-1-AP (same clone as 14956-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 14956-1-AP (BEGAIN antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 14956-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas cancer using 14956-1-AP (same clone as 14956-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 14956-1-AP (BEGAIN antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 14956-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas cancer using 14956-1-AP (same clone as 14956-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 14956-1-AP (BEGAIN antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 14956-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse cerebellum using 14956-1-AP (same clone as 14956-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 14956-1-AP (BEGAIN antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 14956-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse cerebellum using 14956-1-AP (same clone as 14956-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 14956-1-AP (BEGAIN antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 14956-1-PBS in a different storage buffer formulation.

BEGAIN Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 14956-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

14956-1-PBS targets BEGAIN in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6794

  Product name: Recombinant human BEGAIN protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 225-593 aa of BC002607

  Sequence: DIYCSDTALYCPEERRRDRRPSVDAPVTDVGFLRAQNSTDSAAEEEEEAEAAAFPAGFQHEAFPSYAGSLPTSSSYSSFSATSEEKEHAQASTLTASQQAIYLNSRDELFDRKPPATTYEGSPRFAKATAAVAAPLEAEVAPGFGRTMSPYPAETFRFPASPGPQQALMPPNLWSLRAKPGTARLPGEDMRGQWRPLSVEDIGAYSYPVSAAGRASPCSFSERYYGGAGGSPGKKADGRASPLYASYKADSFSEGDDLSQGHLAEPCFLRAGGDLSLSPGRSADPLPGYAPSEGGDGDRLGVQLCGTASSPEPEQGSRDSLEPSSMEASPEMHPAARLSPQQAFPRTGGSGLSRKDSLTKAQLYGTLLN

• Full Name: brain-enriched guanylate kinase-associated homolog (rat)
• Calculated Molecular Weight: 65 kDa
• Observed Molecular Weight: 65-70 kDa
• GenBank Accession Number: BC002607
• Gene Symbol: BEGAIN
• Gene ID (NCBI): 57596
• RRID: AB_2064487
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BUH8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.