BEND2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• BEND2 Polyclonal antibody (24958-1-AP)

• 

  WB analysis using 24958-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 24958-1-AP (BEND2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

BEND2 Polyclonal Antibody for WB, ELISA

Cat No. 24958-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

BEN domain containing 2, CXorf20

---

Tested Applications

• Positive WB detected in: mouse testis tissue, rat testis tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

24958-1-AP targets BEND2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21152

  Product name: Recombinant human BEND2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 298-645 aa of BC096745

  Sequence: FHPNLESGPQMSYGTMSYSTEMKNNCDQDDASASACLTPDFALLPLNILVEVDTNTENSVNTMNRSTLLDSDSGQDSSSSSVCIPPKYGYLGDPKRNVRVLKIHLLAVQNMAKPKQAACYLVRILFSKEILISSSVDIHLKDSQSLDPNKMAALREYLATTFPTCDLHEHGKDWQDCISGINSMIYCLCSEGKSTPKTVRKNKKRTNRVASASADRNDQRGRDGGEGCSWMFQPMNNSKMREKRNLQPNSNAIPEGMREPSTDNPEEPGEAWSYFGRPWRNIRMPCSVLTLAKTKSCASLSARYLIQKLFTKDVLVQSNVYGNLKHGLCALDPNKISALRGLLHIEYV

• Full Name: BEN domain containing 2
• Calculated Molecular Weight: 799 aa, 88 kDa
• Observed Molecular Weight: 130-140 kDa
• GenBank Accession Number: BC096745
• Gene Symbol: BEND2
• Gene ID (NCBI): 139105
• RRID: AB_3742131
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8NDZ0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

BEND2 (BEN domain-containing protein 2) is a novel protein that is specifically expressed in spermatogenic cells around the time of meiotic initiation (PMID: 35613276). BEND2 interacted with a number of chromatin-associated proteins-including ZMYM2, LSD1, CHD4, and ADNP- which are components of certain transcription-repressor complexes. In the testis, Bend2 expresses two protein isoforms: the 130 kDa protein corresponds to the full-length BEND2, which displays a slower electrophoretic mobility due to its unusual sequence/structure. The 75 kDa protein corresponds to a smaller version of BEND2 lacking the N-terminus, p80 .