Home
Products
Primary Antibodies
BET1L Polyclonal antibody, PBS Only (14163-1-PBS)

Filter: AllWBIHC

WB analysis using 14163-1-AP (same clone as 14163-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 14163-1-AP (BET1L antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14163-1-PBS in a different storage buffer formulation.
IHC staining of human cervical cancer using 14163-1-AP (same clone as 14163-1-PBS)
Immunohistochemical analysis of paraffin-embedded human cervical cancer using 14163-1-AP (BET1L antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 14163-1-PBS in a different storage buffer formulation.
IHC staining of human cervical cancer using 14163-1-AP (same clone as 14163-1-PBS)
Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 14163-1-AP (BET1L antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 14163-1-PBS in a different storage buffer formulation.
IHC staining of human cervical cancer using 14163-1-AP (same clone as 14163-1-PBS)
Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 14163-1-AP (BET1L antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 14163-1-PBS in a different storage buffer formulation.
IHC staining of mouse stomach using 14163-1-AP (same clone as 14163-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse stomach tissue slide using 14163-1-AP (BET1L antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 14163-1-PBS in a different storage buffer formulation.
IHC staining of mouse stomach using 14163-1-AP (same clone as 14163-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse stomach tissue slide using 14163-1-AP (BET1L antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 14163-1-PBS in a different storage buffer formulation.

BET1L Polyclonal antibody, PBS Only

Name: BET1L Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 14163-1-PBS

BET1L Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 14163-1-PBS

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

14163-1-PBS targets BET1L in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity	human, mouse
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag5351 Product name: Recombinant human GS15 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-102 aa of BC032779 Sequence: MADWARAQSPGAVEEILDRENKRMADSLASKVTRLKSLALDIDRDAEDQNRYLDGMVRAHGVRVSVPCPSTTCCRACSVSFSTGAGGWSNHHFCVILLGFLP Predict reactive species
Full Name	blocked early in transport 1 homolog (S. cerevisiae)-like
Calculated Molecular Weight	102 aa, 11 kDa
Observed Molecular Weight	13-15 kDa
GenBank Accession Number	BC032779
Gene Symbol	BET1L
Gene ID (NCBI)	51272
RRID	AB_2064737
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q9NYM9
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.