BEX5 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• BEX5 Polyclonal antibody, PBS Only (25281-1-PBS)

• 

  IHC staining of mouse brain using 25281-1-AP (same clone as 25281-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 25281-1-AP (BEX5 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25281-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 25281-1-AP (same clone as 25281-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 25281-1-AP (BEX5 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25281-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 25281-1-AP (same clone as 25281-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 25281-1-AP (BEX5 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25281-1-PBS in a different storage buffer formulation.

BEX5 Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 25281-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, Indirect ELISA

Synonyms

---

Product Information

25281-1-PBS targets BEX5 in IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16446

  Product name: Recombinant human BEX5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-65 aa of BC106955

  Sequence: MENVPKENKVVEKAPVQNEAPALGGGEYQEPGGNVKGVWAPPAPGFGEDVPNRLVDNIDMIDGDG

• Full Name: brain expressed, X-linked 5
• Calculated Molecular Weight: 111 aa, 13 kDa
• GenBank Accession Number: BC106955
• Gene Symbol: BEX5
• Gene ID (NCBI): 340542
• RRID: AB_3085780
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q5H9J7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The Brain-Expressed X-linked (BEX) family proteins are comprised of five human proteins including BEX1, BEX2, BEX3, BEX4, and BEX5. While human BEX5 is widely expressed in many tissues, BEX5 has not been studied well (PMID: 26408910).