BFSP2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• BFSP2 Polyclonal antibody, PBS Only (25438-1-PBS)

• 

  WB analysis using 25438-1-AP (same clone as 25438-1-PBS)

  mouse eye and rat eye tissues were subjected to SDS PAGE followed by western blot with 25438-1-AP (BFSP2 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25438-1-PBS in a different storage buffer formulation.

BFSP2 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 25438-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

Lens intermediate filament-like light, LIFL-L, Phakinin

---

Product Information

25438-1-PBS targets BFSP2 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22073

  Product name: Recombinant human BFSP2 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 1-225 aa of BC113518

  Sequence: MSERRVVVDLPTSASSSMPLQRRRASFRGPRSSSSLESPPASRTNAMSGLVRAPGVYVGTAPSGCIGGLGARVTRRALGISSVFLQGLRSSGLATVPAPGLERDHGAVEDLGGCLVEYMAKVHALEQVSQELETQLRMHLESKATRSGNWGALRASWASSCQQVGEAVLENARLMLQTETIQAGADDFKERYENEQPFRKAAEEEINSLYKVIDEANLTKMDLES

• Full Name: beaded filament structural protein 2, phakinin
• Calculated Molecular Weight: 415 aa, 46 kDa
• Observed Molecular Weight: 45-49 kDa
• GenBank Accession Number: BC113518
• Gene Symbol: BFSP2
• Gene ID (NCBI): 8419
• RRID: AB_2880080
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q13515
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.