BHLHE22 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• BHLHE22 Polyclonal antibody (25622-1-AP)

BHLHE22 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 25622-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

Beta3, BHLHB5, BHLHE22, CAGL85, TNRC20

• 

  WB analysis of SH-SY5Y using 25622-1-AP

  SH-SY5Y cells were subjected to SDS PAGE followed by western blot with 25622-1-AP (BHLHE22 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of SH-SY5Y using 25622-1-AP

  SH-SY5Y cells were subjected to SDS PAGE followed by western blot with 25622-1-AP (BHLHE22 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of SH-SY5Y using 25622-1-AP

  SH-SY5Y cells were subjected to SDS PAGE followed by western blot with 25622-1-AP (BHLHE22 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human brain using 25622-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 25622-1-AP (BHLHE22 Antibody) at dilution of 1:200 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of SH-SY5Y using 25622-1-AP

  Immunofluorescent analysis of SH-SY5Y cells using 25622-1-AP (BHLHE22 antibody) at dilution of 1:25 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: SH-SY5Y cells
• Positive IHC detected in: human brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: SH-SY5Y cells

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

25622-1-AP targets BHLHE22 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, goat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20966

  Product name: Recombinant human BHLHE22 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 1-225 aa of BC156671

  Sequence: MERGMHLGAAAAGEDDLFLHKSLSASTSKRLEAAFRSTPPGMDLSLAPPPRERPASSSSSPLGCFEPADPEGAGLLLPPPGGGGGGSAGSGGGGGGGVGVPGLLVGSAGVGGDPSLSSLPAGAALCLKYGESASRGSVAESSGGEQSPDDDSDGRCELVLRAGVADPRASPGAGGGGAKAAEGCSNAHLHGGASVPPGGLGGGGGGGSSSGSSGGGGGSGSGSGG

• Full Name: basic helix-loop-helix family, member e22
• Calculated Molecular Weight: 381 aa, 37 kDa
• Observed Molecular Weight: 37 kDa
• GenBank Accession Number: BC156671
• Gene Symbol: BHLHE22
• Gene ID (NCBI): 27319
• RRID: AB_2880165
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8NFJ8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Basic helix-loop-helix family member e22 (BHLHE22), a basic helix loop helix transcription factor family member, acts as a transcriptional repressor and has a role in cell differentiation in neuron development (PMID: 36941015). BHLHE22 expression serves as a potential biomarker for ICI treatment prediction and favorable prognosis, and that is associated with microenvironment immune status (PMID: 35806162).

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Cell Metab; Deubiquitinase OTUD3 regulates metabolism homeostasis in response to nutritional stresses.; Authors - Na Zhou
goat	WB	PLoS One; Chi-miR-4110 promotes granulosa cell apoptosis by targeting Sma- and Mad-related protein 2 (Smad2) in the caprine ovary.; Authors - Xiaopeng An
human	IHC	Breast Cancer Res; BHLHE22, targeted by deubiquitinating enzyme OTUD3, exerts an antitumor role in triple-negative breast cancer progression via transcriptionally inhibiting CDT1.; Authors - Lei Jiang