BHLHE40 Polyclonal antibody

• 

  WB analysis using 17895-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 17895-1-AP (BHLHE40 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HeLa using 17895-1-AP

  IP result of anti-BHLHE40 (IP:17895-1-AP, 4ug; Detection:17895-1-AP 1:1000) with HeLa cells lysate 1800 ug.

• 

  IHC staining of mouse stomach using 17895-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse stomach tissue slide using 17895-1-AP (BHLHE40 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human endometrial cancer using 17895-1-AP

  Immunohistochemical analysis of paraffin-embedded human endometrial cancer tissue slide using 17895-1-AP (BHLHE40 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human endometrial cancer using 17895-1-AP

  Immunohistochemical analysis of paraffin-embedded human endometrial cancer tissue slide using 17895-1-AP (BHLHE40 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse stomach using 17895-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse stomach tissue slide using 17895-1-AP (BHLHE40 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human pancreas cancer using 17895-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 17895-1-AP (BHLHE40 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human pancreas cancer using 17895-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 17895-1-AP (BHLHE40 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

BHLHE40 Polyclonal Antibody for WB, IP, IHC, ELISA

Cat No. 17895-1-AP

Publications(16)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, IP, ChIP, ELISA

Synonyms

BHLHB2, BHLHE40, DEC1, SHARP 2, SHARP2, STRA13, Stra14

---

Tested Applications

• Positive WB detected in: C2C12 cells, HeLa cells, MDA-MB-231 cells
• Positive IP detected in: HeLa cells
• Positive IHC detected in: human endometrial cancer tissue, human pancreas cancer tissue, mouse stomach tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 5 publications below
• WB: See 15 publications below
• IHC: See 6 publications below
• IF: See 4 publications below
• IP: See 1 publications below
• ChIP: See 1 publications below

Product Information

17895-1-AP targets BHLHE40 in WB, IHC, IF, IP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12236

  Product name: Recombinant human BHLHE40 protein

  Source: e coli.-derived, T-HIS

  Tag: 6*His

  Domain: 1-412 aa of BC082238

  Sequence: MERIPSAQPPPACLPKAPGLEHGDLPGMYPAHMYQVYKSRRGIKRSEDSKETYKLPHRLIEKKRRDRINECIAQLKDLLPEHLKLTTLGHLEKAVVLELTLKHVKALTNLIDQQQQKIIALQSGLQAGELSGRNVETGQEMFCSGFQTCAREVLQYLAKHENTRDLKSSQLVTHLHRVVSELLQGGTSRKPSDPAPKVMDFKEKPSSPAKGSEGPGKNCVPVIQRTFAHSSGEQSGSDTDTDSGYGGESEKGDLRSEQPCFKSDHGRRFTMGERIGAIKQESEEPPTKKNRMQLSDDEGHFTSSDLISSPFLGPHPHQPPFCLPFYLIPPSATAYLPMLEKCWYPTSVPVLYPGLNASAAALSSFMNPDKISAPLLMPQRLPSPLPAHPSVDSSVLLQALKPIPPLNLETKD

• Full Name: basic helix-loop-helix family, member e40
• Calculated Molecular Weight: 412 aa, 46 kDa
• Observed Molecular Weight: 46-50 kDa
• GenBank Accession Number: BC082238
• Gene Symbol: BHLHE40
• Gene ID (NCBI): 8553
• RRID: AB_2065351
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O14503
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

BHLHE40 (Basic Helix-Loop-Helix Family Member E40), also known as BHLHB2, STRA13, DEC1, or SHARP2, is a member of the basic helix-loop-helix (bHLH) protein family, a large superfamily of transcriptional regulators expressed in many organisms. BHLHE40 is known to regulate a wide variety of essential cellular processes, including cell cycle, cellular proliferation, programmed cell death, cellular development and differentiation, as well as circadian rhythms (PMID: 34551158). It is reported that BHLHE40 is overexpressed in gastric, breast, and brain tumors; and downregulated in colorectal, esophageal, pancreatic and lung cancer (PMID: 32577154).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse,rat	WB	Front Cell Dev Biol; Bhlhe40/Sirt1 Axis-Regulated Mitophagy Is Implicated in All-Trans Retinoic Acid-Induced Spina Bifida Aperta.; Authors - Lu Zhao ; KD Validated
human	WB	Ann N Y Acad Sci; LncRNA-ES3 inhibition by Bhlhe40 is involved in high glucose-induced calcification/senescence of vascular smooth muscle cells.; Authors - Jia-Yu Zhong
mouse	WB,IF	Front Cardiovasc Med; 17β-Estradiol Inhibits Proliferation and Oxidative Stress in Vascular Smooth Muscle Cells by Upregulating BHLHE40 Expression.; Authors - Dan-Dan Feng ; KD Validated
human	WB	Biochem Biophys Res Commun; Loss of circadian protein TIMELESS accelerates the progression of cellular senescence.; Authors - Xiaomeng Shen
human	IP,WB,IF	J Physiol Biochem; Long noncoding RNA SNHG1 alleviates high glucose-induced vascular smooth muscle cells calcification/senescence by post-transcriptionally regulating Bhlhe40 and autophagy via Atg10; Authors - Shuang Li
human,mouse	WB,IHC	Front Cardiovasc Med; Cardiac-specific knockdown of Bhlhe40 attenuates angiotensin II (Ang II)-Induced atrial fibrillation in mice; Authors - Kai-Wen Ren