BHLHE40 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• BHLHE40 Polyclonal antibody (17895-1-AP)

• Featured Product
• KD/KO Validated

BHLHE40 Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 17895-1-AP

Publications(25)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF, IP, ChIP, ELISA

Synonyms

DEC1, bHLHb2, Class B basic helix-loop-helix protein 2, Class E basic helix-loop-helix protein 40, Enhancer-of-split and hairy-related protein 2

• 

  WB analysis using 17895-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 17895-1-AP (BHLHE40 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 17895-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 17895-1-AP (BHLHE40 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HeLa using 17895-1-AP

  IP result of anti-BHLHE40 (IP:17895-1-AP, 4ug; Detection:17895-1-AP 1:1000) with HeLa cells lysate 1800 ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse stomach using 17895-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse stomach tissue slide using 17895-1-AP (BHLHE40 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human endometrial cancer using 17895-1-AP

  Immunohistochemical analysis of paraffin-embedded human endometrial cancer tissue slide using 17895-1-AP (BHLHE40 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human endometrial cancer using 17895-1-AP

  Immunohistochemical analysis of paraffin-embedded human endometrial cancer tissue slide using 17895-1-AP (BHLHE40 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse stomach using 17895-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse stomach tissue slide using 17895-1-AP (BHLHE40 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human pancreas cancer using 17895-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 17895-1-AP (BHLHE40 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human pancreas cancer using 17895-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 17895-1-AP (BHLHE40 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: HepG2 cells, C2C12 cells, HeLa cells, MDA-MB-231 cells, L02 cells
• Positive IP detected in: HeLa cells
• Positive IHC detected in: human endometrial cancer tissue, human pancreas cancer tissue, mouse stomach tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

17895-1-AP targets BHLHE40 in WB, IHC, IF, IP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, bovine
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12236

  Product name: Recombinant human BHLHE40 protein

  Source: e coli.-derived, T-HIS

  Tag: 6*His

  Domain: 1-412 aa of BC082238

  Sequence: MERIPSAQPPPACLPKAPGLEHGDLPGMYPAHMYQVYKSRRGIKRSEDSKETYKLPHRLIEKKRRDRINECIAQLKDLLPEHLKLTTLGHLEKAVVLELTLKHVKALTNLIDQQQQKIIALQSGLQAGELSGRNVETGQEMFCSGFQTCAREVLQYLAKHENTRDLKSSQLVTHLHRVVSELLQGGTSRKPSDPAPKVMDFKEKPSSPAKGSEGPGKNCVPVIQRTFAHSSGEQSGSDTDTDSGYGGESEKGDLRSEQPCFKSDHGRRFTMGERIGAIKQESEEPPTKKNRMQLSDDEGHFTSSDLISSPFLGPHPHQPPFCLPFYLIPPSATAYLPMLEKCWYPTSVPVLYPGLNASAAALSSFMNPDKISAPLLMPQRLPSPLPAHPSVDSSVLLQALKPIPPLNLETKD

• Full Name: basic helix-loop-helix family, member e40
• Calculated Molecular Weight: 412 aa, 46 kDa
• Observed Molecular Weight: 46-50 kDa
• GenBank Accession Number: BC082238
• Gene Symbol: BHLHE40
• Gene ID (NCBI): 8553
• RRID: AB_2065351
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O14503
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

BHLHE40 (Basic Helix-Loop-Helix Family Member E40), also known as BHLHB2, STRA13, DEC1, or SHARP2, is a member of the basic helix-loop-helix (bHLH) protein family, a large superfamily of transcriptional regulators expressed in many organisms. BHLHE40 is known to regulate a wide variety of essential cellular processes, including cell cycle, cellular proliferation, programmed cell death, cellular development and differentiation, as well as circadian rhythms (PMID: 34551158). It is reported that BHLHE40 is overexpressed in gastric, breast, and brain tumors; and downregulated in colorectal, esophageal, pancreatic and lung cancer (PMID: 32577154).

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse		Immunity; Progranulin deficiency-induced lysosomal dysfunction drives maladaptive myeloid cell states through the MITF/TFE transcription factors; Authors - Leon Tejwani
		Cancer Discov; Senescent-like neutrophils shape angiogenic immunosuppressive niches in colorectal cancer liver metastasis.; Authors - Zhihang Chen
human	WB	Cancer Res; Single-Cell and Spatial Transcriptome Profiling Identifies the Transcription Factor BHLHE40 as a Driver of EMT in Metastatic Colorectal Cancer; Authors - Sheng Yang ; KD Validated
human	WB	Adv Sci (Weinh); The PRMT6/PARP1/CRL4B Complex Regulates the Circadian Clock and Promotes Breast Tumorigenesis; Authors - Tianshu Yang
human	IF	Adv Sci (Weinh); BHLHE40 Cooperates with GATA2/3 to Control Human Syncytiotrophoblast Lineage Differentiation.; Authors - Lijin Peng
rat,mouse	WB,IHC,IF,ChIP	Cell Commun Signal; DEC1 is involved in circadian rhythm disruption-exacerbated pulmonary fibrosis; Authors - Shuai-Jun Chen