BHLHE40 Monoclonal antibody, PBS Only

• 

  WB analysis using 68435-1-Ig (same clone as 68435-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68435-1-Ig (BHLHE40 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68435-1-PBS in a different storage buffer formulation.

BHLHE40 Monoclonal Antibody for WB, Indirect ELISA

Cat No. 68435-1-PBS

Clone No.1A3E1

Host / Isotype

Mouse / IgG2a

Reactivity

Human

Applications

WB, Indirect ELISA

Synonyms

BHLHB2, BHLHE40, DEC1, FLJ99214, SHARP 2, SHARP2, STRA13, Stra14

---

Product Information

68435-1-PBS targets BHLHE40 in WB, Indirect ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12236

  Product name: Recombinant human BHLHE40 protein

  Source: e coli.-derived, T-HIS

  Tag: 6*His

  Domain: 1-412 aa of BC082238

  Sequence: MERIPSAQPPPACLPKAPGLEHGDLPGMYPAHMYQVYKSRRGIKRSEDSKETYKLPHRLIEKKRRDRINECIAQLKDLLPEHLKLTTLGHLEKAVVLELTLKHVKALTNLIDQQQQKIIALQSGLQAGELSGRNVETGQEMFCSGFQTCAREVLQYLAKHENTRDLKSSQLVTHLHRVVSELLQGGTSRKPSDPAPKVMDFKEKPSSPAKGSEGPGKNCVPVIQRTFAHSSGEQSGSDTDTDSGYGGESEKGDLRSEQPCFKSDHGRRFTMGERIGAIKQESEEPPTKKNRMQLSDDEGHFTSSDLISSPFLGPHPHQPPFCLPFYLIPPSATAYLPMLEKCWYPTSVPVLYPGLNASAAALSSFMNPDKISAPLLMPQRLPSPLPAHPSVDSSVLLQALKPIPPLNLETKD

• Full Name: basic helix-loop-helix family, member e40
• Calculated Molecular Weight: 412 aa, 46 kDa
• Observed Molecular Weight: 46-50 kDa
• GenBank Accession Number: BC082238
• Gene Symbol: BHLHE40
• Gene ID (NCBI): 8553
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O14503
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

BHLHE40 (Basic Helix-Loop-Helix Family Member E40), also known as BHLHB2, STRA13, DEC1, or SHARP2, is a member of the basic helix-loop-helix (bHLH) protein family, a large superfamily of transcriptional regulators expressed in many organisms. BHLHE40 is known to regulate a wide variety of essential cellular processes, including cell cycle, cellular proliferation, programmed cell death, cellular development and differentiation, as well as circadian rhythms (PMID: 34551158). It is reported that BHLHE40 is overexpressed in gastric, breast, and brain tumors; and downregulated in colorectal, esophageal, pancreatic and lung cancer (PMID: 32577154).