BHLHE40 Monoclonal antibody

• 

  WB analysis using 68435-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 68435-1-Ig (BHLHE40 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

BHLHE40 Monoclonal Antibody for WB, ELISA

Cat No. 68435-1-Ig

Clone No.1A3E1

Host / Isotype

Mouse / IgG2a

Reactivity

Human

Applications

WB, ELISA

Synonyms

BHLHB2, BHLHE40, DEC1, FLJ99214, SHARP 2, SHARP2, STRA13, Stra14

---

Tested Applications

• Positive WB detected in: Calu-3 cells, A549 cells, HCT 116 cells, MDA-MB-468 cells, Saos-2 cells, HeLa cells, PC-3 cells, K-562 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

68435-1-Ig targets BHLHE40 in WB, ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12236

  Product name: Recombinant human BHLHE40 protein

  Source: e coli.-derived, T-HIS

  Tag: 6*His

  Domain: 1-412 aa of BC082238

  Sequence: MERIPSAQPPPACLPKAPGLEHGDLPGMYPAHMYQVYKSRRGIKRSEDSKETYKLPHRLIEKKRRDRINECIAQLKDLLPEHLKLTTLGHLEKAVVLELTLKHVKALTNLIDQQQQKIIALQSGLQAGELSGRNVETGQEMFCSGFQTCAREVLQYLAKHENTRDLKSSQLVTHLHRVVSELLQGGTSRKPSDPAPKVMDFKEKPSSPAKGSEGPGKNCVPVIQRTFAHSSGEQSGSDTDTDSGYGGESEKGDLRSEQPCFKSDHGRRFTMGERIGAIKQESEEPPTKKNRMQLSDDEGHFTSSDLISSPFLGPHPHQPPFCLPFYLIPPSATAYLPMLEKCWYPTSVPVLYPGLNASAAALSSFMNPDKISAPLLMPQRLPSPLPAHPSVDSSVLLQALKPIPPLNLETKD

• Full Name: basic helix-loop-helix family, member e40
• Calculated Molecular Weight: 412 aa, 46 kDa
• Observed Molecular Weight: 46-50 kDa
• GenBank Accession Number: BC082238
• Gene Symbol: BHLHE40
• Gene ID (NCBI): 8553
• RRID: AB_3085148
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O14503
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

BHLHE40 (Basic Helix-Loop-Helix Family Member E40), also known as BHLHB2, STRA13, DEC1, or SHARP2, is a member of the basic helix-loop-helix (bHLH) protein family, a large superfamily of transcriptional regulators expressed in many organisms. BHLHE40 is known to regulate a wide variety of essential cellular processes, including cell cycle, cellular proliferation, programmed cell death, cellular development and differentiation, as well as circadian rhythms (PMID: 34551158). It is reported that BHLHE40 is overexpressed in gastric, breast, and brain tumors; and downregulated in colorectal, esophageal, pancreatic and lung cancer (PMID: 32577154).