BHMT Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 86372-1-RR (same clone as 86372-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86372-1-RR (BHMT antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86372-1-PBS in a different storage buffer formulation.

• 

  IP experiment of rat liver using 86372-1-RR (same clone as 86372-1-PBS)

  IP result of anti-BHMT (IP:86372-1-RR, 4ug; Detection:86372-1-RR 1:3000) with rat liver tissue lysate 3080 ug. This data was developed using the same antibody clone with 86372-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 86372-1-RR

  Biolayer interferometry (BLl) kinetic assays of 86372-1-RR against Human BHMT were performed. The affinity constant is below 1 pM.

BHMT Uni-rAb^® Recombinant Antibody for WB, IP, Indirect ELISA

Cat No. 86372-1-PBS

Clone No.250978E3

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, IP, Indirect ELISA

Synonyms

Betaine--homocysteine S-methyltransferase 1, EC:2.1.1.5

---

Product Information

86372-1-PBS targets BHMT in WB, IP, Indirect ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag8738

  Product name: Recombinant human BHMT protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-406 aa of BC012616

  Sequence: MPPVGGKKAKKGILERLNAGEIVIGDGGFVFALEKRGYVKAGPWTPEAAVEHPEAVRQLHREFLRAGSNVMQTFTFYASEDKLENRGNYVLEKISGQEVNEAACDIARQVADEGDALVAGGVSQTPSYLSCKSETEVKKVFLQQLEVFMKKNVDFLIAEYFEHVEEAVWAVETLIASGKPVAATMCIGPEGDLHGVPPGECAVRLVKAGASIIGVNCHFDPTISLKTVKLMKEGLEAARLKAHLMSQPLAYHTPDCNKQGFIDLPEFPFGLEPRVATRWDIQKYAREAYNLGVRYIGGCCGFEPYHIRAIAEELAPERGFLPPASEKHGSWGSGLDMHTKPWVRARARKEYWENLRIASGRPYNPSMSKPDGWGVTKGTAELMQQKEATTEQQLKELFEKQKFKSQ

• Full Name: betaine-homocysteine methyltransferase
• Calculated Molecular Weight: 406 aa, 45 kDa
• Observed Molecular Weight: 45 kDa
• GenBank Accession Number: BC012616
• Gene Symbol: BHMT
• Gene ID (NCBI): 635
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q93088
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Betaine-homocysteine methyltransferase (BHMT) is a cytosolic enzyme that Involved in the regulation of homocysteine metabolism. BHMT catalyzes the conversion of betaine and homocysteine to dimethylglycine and methionine, respectively. This reaction is also required for the irreversible oxidation of choline(PMID: 8798461, 10529246).